Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.17
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5BVD1 B4DNV2 B4E0Z2 Q96AJ4 Q9H5Q1
Symbols TTMP

Gene

AA Sequence

MDLAQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCKLWMII      1 - 70
TSIFLGVITVIIIGLCLAAVTYVDEDENEILELSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTS     71 - 140
PSLGRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP    141 - 210
TSLLLYE                                                                   211 - 217
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15737651 2005 Identification and in silico characterization of a novel gene: TPA induced trans-membrane protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.