Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.17
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 3.67755324173706E-8
interstitial cystitis 2299 2.67128032388201E-5
medulloblastoma, large-cell 6234 4.2198837569493E-5
ovarian cancer 8492 0.00125680353657322
adult high grade glioma 2148 0.00140180702727398
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00220187831789438
invasive ductal carcinoma 2950 0.00276701011708073
ductal carcinoma in situ 1745 0.0185967150241024
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0489981404815813

Expression

Synonym

Accession Q5BVD1 B4DNV2 B4E0Z2 Q96AJ4 Q9H5Q1
Symbols TTMP

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

AA Sequence

MDLAQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCKLWMII      1 - 70
TSIFLGVITVIIIGLCLAAVTYVDEDENEILELSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTS     71 - 140
PSLGRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP    141 - 210
TSLLLYE                                                                   211 - 217
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15737651 2005 Identification and in silico characterization of a novel gene: TPA induced trans-membrane protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.