Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
urothelial carcinoma 1.200 0.046
intraductal papillary-mucinous adenoma (... -1.700 0.001
interstitial cystitis 1.500 0.000
Breast cancer 1.200 0.000
ovarian cancer 2.300 0.000

Gene RIF (1)

PMID Text
21287218 C4Orf48 probably encodes a novel neuropeptide, which, if hemizygously deleted, may be involved in the observed intellectual and fine motor disabilities and thus in the overall neurological aspects of Wolf-Hirschhorn syndrome.

AA Sequence

MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACS      1 - 70
LDARTETLLLQAERRALCACWPAGH                                                  71 - 95
//

Publication (5)

PMID Year Title
21287218 2011 C4ORF48, a gene from the Wolf-Hirschhorn syndrome critical region, encodes a putative neuropeptide and is expressed during neocortex and cerebellar development.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15809229 2005 Comparative gene finding in chicken indicates that we are closing in on the set of multi-exonic widely expressed human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.