Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.200 1.6e-04
interstitial cystitis 1.500 2.1e-05
intraductal papillary-mucinous adenoma (... -1.700 8.8e-04
ovarian cancer 2.300 2.0e-05
urothelial carcinoma 1.200 4.6e-02

Synonym

Accession Q5BLP8 B6ZDN0 B7ZBI7 B7ZBI8 X6RBU3
Symbols CHR4_55

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACS      1 - 70
LDARTETLLLQAERRALCACWPAGH                                                  71 - 95
//

Text Mined References (5)

PMID Year Title