Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.94
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 640 0.0 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.041 3.6e-06
Breast cancer -1.200 1.4e-10
group 3 medulloblastoma 1.100 1.6e-02
juvenile dermatomyositis 1.106 5.5e-11
osteosarcoma -1.591 3.4e-06
ovarian cancer 1.300 4.0e-03

Gene RIF (4)

AA Sequence

MDFEDDYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDSYLNQSYGMDNHSGGGGGSR      1 - 70
FGPYESYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSK     71 - 140
LRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAYPESTFGSRNYDAFGGPSTGRGRGRGHMGDF    141 - 210
GSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKISLSKSPTKTDPKNEE    211 - 280
EEKRRIEARREKQRRRREKNSEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESSSHQETLDHIQKQTKFD    281 - 350
KVVMEFLHECMVNKFKKTSIRKQQTNNQTEVVKIIEKDVMEGVTVDDHMMKVETVHCSACSVYIPALHSS    351 - 420
VQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQIEGDEEDE    421 - 490
EKIDEPIEEEEDEDEEEEAEEVGEVEEVEEVEEVREGGIEGEGNIQGVGEGGEVGVVGEVEGVGEVEEVE    491 - 560
ELEEETAKEEPADFPVEQPEEN                                                    561 - 582
//

Text Mined References (23)

PMID Year Title