Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.11
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.591 0.000
juvenile dermatomyositis 1.106 0.000
acute quadriplegic myopathy 1.041 0.000
group 3 medulloblastoma 1.400 0.001
Breast cancer -1.200 0.000
ovarian cancer 1.300 0.004

Synonym

Accession Q5BKZ1 A8MYX1 B4DLN0 B4E179 Q5VW93 Q5VW94 Q5VW96 Q5VW97 Q6NSA2 Q7Z638 Q7Z6C2
Symbols ZIRD
ZAN75
Zfp326
dJ871E2.1

Gene

Gene RIF (3)

PMID Text
25496916 Zinc finger protein 326 (ZNF326) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22666313 involvement of the Zfp326 and ZNF326 genes in antidepressant treatment response
22446626 data indicate that the DBIRD complex (consisting of DBC1 and ZNF326) acts at the interface between mRNP particles and RNAPII, integrating transcript elongation with the regulation of alternative splicing

AA Sequence

MDFEDDYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDSYLNQSYGMDNHSGGGGGSR      1 - 70
FGPYESYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSK     71 - 140
LRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAYPESTFGSRNYDAFGGPSTGRGRGRGHMGDF    141 - 210
GSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKISLSKSPTKTDPKNEE    211 - 280
EEKRRIEARREKQRRRREKNSEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESSSHQETLDHIQKQTKFD    281 - 350
KVVMEFLHECMVNKFKKTSIRKQQTNNQTEVVKIIEKDVMEGVTVDDHMMKVETVHCSACSVYIPALHSS    351 - 420
VQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQIEGDEEDE    421 - 490
EKIDEPIEEEEDEDEEEEAEEVGEVEEVEEVEEVREGGIEGEGNIQGVGEGGEVGVVGEVEGVGEVEEVE    491 - 560
ELEEETAKEEPADFPVEQPEEN                                                    561 - 582
//

Publication (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22666313 2012 Convergent evidence from mouse and human studies suggests the involvement of zinc finger protein 326 gene in antidepressant treatment response.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22446626 2012 DBIRD complex integrates alternative mRNA splicing with RNA polymerase II transcript elongation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20197096 2010 Genome-wide analysis reveals novel genes influencing temporal lobe structure with relevance to neurodegeneration in Alzheimer's disease.
More...