Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.38
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWK      1 - 70
KELEKHREKLLSGSESSSKKRQRKKKEKKKSGRYSSSSSSSSDSSSSSSDSEDEDKKQGKRRKKKKNRSH     71 - 140
KSSESSMSETESDSKDSLKKKKKSKDGTEKEKDIKGLSKKRKMYSEDKPLSSESLSESEYIEEVRAKKKK    141 - 210
SSEEREKATEKTKKKKKHKKHSKKKKKKAASSSPDSP                                     211 - 247
//

Text Mined References (15)

PMID Year Title