Knowledge Summary

Patent

No data available

Synonym

Accession Q5BKY6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MKKRHREGCDMPGPWSTLRSHRGHHCPHLHPVLRRPTLTDVEGCLQCLDVCGHPRHAVDAHLLHASALDL      1 - 70
LHALAHDVGHLGPLSPAGGGNVLSVLTALLGP                                           71 - 102
//

Text Mined References (2)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).