Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.10
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Dilated cardiomyopathy 50 3.934 2.0

Gene RIF (1)

PMID Text
26017719 This study firstly reports the association of LRRC10 mutations with enhanced susceptibility to dilated cardiomyopathy in humans.

AA Sequence

MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLSDNHLNSLPPE      1 - 70
LGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVV     71 - 140
CELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDVDWNSIRYFPSLAH    141 - 210
LSSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS       211 - 277
//

Text Mined References (6)

PMID Year Title
26017719 2015 Prevalence and spectrum of LRRC10 mutations associated with idiopathic dilated cardiomyopathy.
18391951 2008 Many sequence variants affecting diversity of adult human height.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14751244 2004 Molecular cloning and expression of HRLRRP, a novel heart-restricted leucine-rich repeat protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.