Property Summary

NCBI Gene PubMed Count 12
PubMed Score 31.10
PubTator Score 16.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.6e-05
group 3 medulloblastoma 4104 7.4e-05
Breast cancer 3578 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Bejel 5 5.264 2.6
Yaws 7 4.304 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.200 3.3e-02
group 3 medulloblastoma 2.400 7.4e-05
juvenile dermatomyositis 1.106 1.6e-05

Gene RIF (3)

AA Sequence

MEHNGSASNADKIHQNRLSSVTEDEDQDAALTIVTVLDKVASIVDSVQASQKRIEERHREMENAIKSVQI      1 - 70
DLLKLSQSHSNTGHIINKLFEKTRKVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFR     71 - 140
CPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVEESRSARLRKSGKEHIDNIKKAFSKENMQKT    141 - 210
RQNLDKKVNRIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNAAPSKEAFKMRSLRKGKDR    211 - 280
TVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKV    281 - 350
EDDESLLLDLKHSS                                                            351 - 364
//

Text Mined References (16)

PMID Year Title