Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $79,653.5
PubMed Score 31.06
PubTator Score 16.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.400 0.000
juvenile dermatomyositis 1.106 0.000
Breast cancer 1.200 0.033

Gene RIF (3)

PMID Text
26086601 MURC/cavin-4, especially in combination with Cav-3, may play a consistent role in the differentiation process of rhabdomyosarcoma.
21642240 MURC mutations impart loss-of-function effects on MURC functions and probably are causal variants in human dilated cardiomyopathy
18332105 MURC modulates RhoA signaling, and MURC plays an important role in the development of cardiac dysfunction and conduction disturbance with increased vulnerability to atrial arrhythmias.

AA Sequence

MEHNGSASNADKIHQNRLSSVTEDEDQDAALTIVTVLDKVASIVDSVQASQKRIEERHREMENAIKSVQI      1 - 70
DLLKLSQSHSNTGHIINKLFEKTRKVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFR     71 - 140
CPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVEESRSARLRKSGKEHIDNIKKAFSKENMQKT    141 - 210
RQNLDKKVNRIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNAAPSKEAFKMRSLRKGKDR    211 - 280
TVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKV    281 - 350
EDDESLLLDLKHSS                                                            351 - 364
//

Text Mined References (12)

PMID Year Title
26086601 2015 MURC/cavin-4 Is Co-Expressed with Caveolin-3 in Rhabdomyosarcoma Tumors and Its Silencing Prevents Myogenic Differentiation in the Human Embryonal RD Cell Line.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
23272181 2012 FSHD myotubes with different phenotypes exhibit distinct proteomes.
21642240 2011 Molecular genetic and functional characterization implicate muscle-restricted coiled-coil gene (MURC) as a causal gene for familial dilated cardiomyopathy.
19546242 2009 MURC/Cavin-4 and cavin family members form tissue-specific caveolar complexes.
18508909 2008 MURC, a muscle-restricted coiled-coil protein, is involved in the regulation of skeletal myogenesis.
18332105 2008 MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...