Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.37928897312926E-10
medulloblastoma 1524 1.7586660864073E-8
glioblastoma 5572 8.15367730743217E-8
pilocytic astrocytoma 3086 4.0332503154413E-7
adult high grade glioma 2148 1.43587742855803E-6
pituitary cancer 1972 1.20303304091258E-5
medulloblastoma, large-cell 6234 4.6235768886966E-5
primitive neuroectodermal tumor 3031 4.63096446582406E-5
atypical teratoid / rhabdoid tumor 4369 5.9841814339283E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0011622393951309
ovarian cancer 8492 0.00120571356763369
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00190213160441648
osteosarcoma 7933 0.00219997539716452
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00636857557594368
lung adenocarcinoma 2714 0.0121427410113335
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0123395280198514
subependymal giant cell astrocytoma 2287 0.023343461180275
gastric carcinoma 832 0.0486249077991548

Expression

Synonym

Accession Q5BKX6 Q6ZRI2 Q9ULU3
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MKMAPQNADPESMQVQELSVPLPDPQKAGGAEAENCETISEGSIDRIPMRLWVMHGAVMFGREFCYAMET      1 - 70
ALVTPILLQIGLPEQYYSLTWFLSPILGLIFTPLIGSASDRCTLSWGRRRPFILALCVGVLFGVALFLNG     71 - 140
SAIGLALGDVPNRQPIGIVLTVLGVVVLDFSADATEGPIRAYLLDVVDSEEQDMALNIHAFSAGLGGAIG    141 - 210
YVLGGLDWTQTFLGSWFRTQNQVLFFFAAIIFTVSVALHLFSIDEEQYSPQQERSAEEPGALDGGEPHGV    211 - 280
PAFPDEVQSEHELALDYPDVDIMRSKSDSALHVPDTALDLEPELLFLHDIEPSIFHDASYPATPRSTSQE    281 - 350
LAKTKLPRLATFLKEAAKEDETLLDNHLNEAKVPNGSGSPTKDALGGYTRVDTKPSATSSSMRRRRHAFR    351 - 420
RQASSTFSYYGKLGSHCYRYRRANAVVLIKPSRSMSDLYDMQKRQRQHRHRNQSGATTSSGDTESEEGEG    421 - 490
ETTVRLLWLSMLKMPRELMRLCLCHLLTWFSVIAEAVFYTDFMGQVIFEGDPKAPSNSTAWQAYNAGVKM    491 - 560
GCWGLVIYAATGAICSALLQKYLDNYDLSVRVIYVLGTLGFSVGTAVMAMFPNVYVAMVTISTMGIVSMS    561 - 630
ISYCPYALLGQYHDIKQYIHHSPGNSKRGFGIDCAILSCQVYISQILVASALGGVVDAVGTVRVIPMVAS    631 - 700
VGSFLGFLTATFLVIYPNVSEEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKLTRKEGLQGPVETESVV      701 - 768
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.