Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.600 6.9e-05
atypical teratoid / rhabdoid tumor 1.700 9.9e-09
ependymoma 1.400 5.9e-12
glioblastoma 1.300 9.8e-09
medulloblastoma 1.100 1.2e-04
medulloblastoma, large-cell 1.400 3.7e-04
non primary Sjogren syndrome sicca 1.200 1.4e-02
osteosarcoma -2.577 9.8e-07
primitive neuroectodermal tumor 1.600 2.6e-05
psoriasis -1.400 9.2e-05

AA Sequence

MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQTPVPPPLPLPPPPAATGPAPR      1 - 70
HVFGLEKSQLLKEAFDKAGPVPKGREDVKRLLKLHKDRFRGDLRWILFCADLPSLIQEGPQCGLVALWMA     71 - 140
GTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVLQHLVTG    141 - 210
HPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLPEEG    211 - 280
SPGAVYLLSKQGKSWHYQLWDYDQVRESNLQLTDFSPSRATDGRVYVVPVGGVRAGLCGQALLLTPQDCS    281 - 350
H//

Text Mined References (9)

PMID Year Title