Property Summary

NCBI Gene PubMed Count 9
PubMed Score 19.14
PubTator Score 2.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Long Qt Syndrome 2 5 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
3-M syndrome 15 3.439 1.7
Long QT syndrome 39 3.057 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.8e-05
group 4 medulloblastoma 1.100 5.6e-05
non-small cell lung cancer 1.103 6.9e-13
pediatric high grade glioma 1.100 1.3e-05
primitive neuroectodermal tumor 1.200 1.6e-04

Gene RIF (1)

AA Sequence

MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYL      1 - 70
VSIGVIKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFCKVQPRNKAASSIQRVLSTLTLAVF     71 - 140
PTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWK    141 - 210
TELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLLTWPYILLGFLFCAFVVVNGGIVIGDRS    211 - 280
SHEACLHFPQLFYFFSFTLFFSFPHLLSPSKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLAD    281 - 350
NRHYTFYVWKRVFQRYETVKYLLVPAYIFAGWSIADSLKSKSIFWNLMFFICLFTVIVPQKLLEFRYFIL    351 - 420
PYVIYRLNIPLPPTSRLICELSCYAVVNFITFFIFLNKTFQWPNSQDIQRFMW                     421 - 473
//

Text Mined References (9)

PMID Year Title