Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
pituitary cancer 1972 2.9e-05
ovarian cancer 8520 1.8e-03
progressive supranuclear palsy 676 1.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer -1.400 1.8e-03
pituitary cancer 1.300 2.9e-05
progressive supranuclear palsy -1.200 1.6e-02

AA Sequence

MDSSRARQQLRRRFLILPDAEAQLDREGDAGPETSTAVEKKEKPLPRLNIHSGFWILASIVVTYYVDFFK      1 - 70
TLKENFHTSSWFLCGSALLLVSLSIAFYCIVYLEWYCGIGEYDVKYPALIPITTASFIAAGICFNIALWH     71 - 140
VWSFFTPLLLFTQFMGVVMFITLLG                                                 141 - 165
//

Text Mined References (7)

PMID Year Title