Property Summary

NCBI Gene PubMed Count 28
PubMed Score 29.84
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
glioblastoma multiforme 142 2.9e-17
atypical teratoid / rhabdoid tumor 5112 2.6e-05
group 4 medulloblastoma 1855 5.8e-04
ependymoma 4679 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Latex allergy 4 4.011 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.6e-05
ependymoma 2.300 1.0e-02
glioblastoma multiforme 1.100 2.9e-17
group 4 medulloblastoma 1.100 5.8e-04

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP      1 - 70
GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSE     71 - 140
VKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSK    141 - 210
LVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCK    211 - 280
EDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQ    281 - 350
AQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYA    351 - 420
EQLHVQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLEEKMREDRDSL    421 - 490
VERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMKTRLEADEV    491 - 560
AAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAI    561 - 630
ISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLR    631 - 700
LEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADR    701 - 770
RYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA               771 - 829
//

Text Mined References (36)

PMID Year Title