Property Summary

NCBI Gene PubMed Count 21
Grant Count 12
Funding $882,700.84
PubMed Score 28.52
PubTator Score 20.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 2.300 0.010
glioblastoma multiforme 1.100 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
group 4 medulloblastoma 1.100 0.001

Gene RIF (7)

PMID Text
22911743 Cby plays an important role in organization of both primary and motile cilia in collaboration with Cnx.
21325031 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20234188 Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation.
19386263 A splice variant of hODF2 called hCenexin1, but not hODF2 itself, efficiently localizes to somatic centrosomes via a variant-specific C-terminal extension and recruits Plk1 through a Cdc2-dependent phospho-S796 motif within the extension.
16966375 We propose that hCenexin1 is a critical centrosomal component whose C-terminal extension is required for proper recruitment of Plk1 and other components crucial for normal mitosis.
9740324 Mouse and rat ODF2 protein homolog sequences and expression are compared.

AA Sequence

MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP      1 - 70
GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSE     71 - 140
VKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSK    141 - 210
LVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCK    211 - 280
EDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQ    281 - 350
AQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYA    351 - 420
EQLHVQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLEEKMREDRDSL    421 - 490
VERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMKTRLEADEV    491 - 560
AAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAI    561 - 630
ISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLR    631 - 700
LEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADR    701 - 770
RYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA               771 - 829
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400999 2013 The microtubule affinity regulating kinase MARK4 promotes axoneme extension during early ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911743 2012 A Wnt/beta-catenin pathway antagonist Chibby binds Cenexin at the distal end of mother centrioles and functions in primary cilia formation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21325031 2011 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...