Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.79
PubTator Score 16.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma 1.200 1.6e-02
atypical teratoid / rhabdoid tumor 1.900 2.5e-06
Breast cancer 2.700 2.8e-02
breast carcinoma 1.100 1.4e-10
colon cancer 1.600 4.8e-04
ductal carcinoma in situ 1.700 2.8e-02
esophageal adenocarcinoma 1.900 1.8e-02
glioblastoma 1.800 3.2e-04
group 3 medulloblastoma 1.300 8.8e-03
interstitial cystitis -3.300 6.1e-04
intraductal papillary-mucinous adenoma (... -4.200 2.2e-04
intraductal papillary-mucinous carcinoma... -2.900 1.7e-03
intraductal papillary-mucinous neoplasm ... -3.300 7.4e-03
invasive ductal carcinoma -1.082 3.8e-03
lung cancer 1.300 5.4e-04
malignant mesothelioma 1.300 7.8e-05
medulloblastoma, large-cell 3.900 6.2e-07
Multiple myeloma 1.440 8.1e-03
nasopharyngeal carcinoma 1.600 1.7e-04
oligodendroglioma 1.500 1.1e-02
osteosarcoma 3.951 5.8e-07
pancreatic cancer -1.100 3.7e-02
pancreatic ductal adenocarcinoma liver m... -1.557 5.1e-03
pituitary cancer 1.300 2.0e-03
primitive neuroectodermal tumor 2.100 1.9e-04
psoriasis -1.900 2.7e-05
sarcoidosis -1.100 3.0e-02

Gene RIF (12)

AA Sequence

MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL      1 - 70
FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER     71 - 140
LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK                                      141 - 176
//

Text Mined References (29)

PMID Year Title