Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.79
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.1e-04
ductal carcinoma in situ -1.600 2.4e-04
glioblastoma 1.200 2.6e-02
invasive ductal carcinoma -2.200 3.9e-04
lung carcinoma 1.400 4.0e-15
medulloblastoma, large-cell 1.300 5.3e-04
ovarian cancer 1.300 6.1e-10

Gene RIF (2)

AA Sequence

MTENKTVSSSSTRDDQTNIGLTCQEVKALREKAWSRTNEGNAMSQSLVLYGASKENSEGFHESKMTNTEG      1 - 70
VNKGIYFSYPCRRHSCAVVNIPAPCVNKMISHIQDVESKIQEHLKRFETSFEEWSRTSSTKDLKEDWSVT     71 - 140
TPVKEVKPGEKRDEKCPELKQEMETLLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKL    141 - 210
QELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE    211 - 280
LQDLKNHYKKKMEVMDLHRKVNEELEEALEACENARLKAQQIKEEIDKDIYQDEKTIEAYKREIYQLNSL    281 - 350
FDHYSSSVINVNTNIEEKEEEVTEAIRETKSSKNELHSLSKMLEDLRRVYDQLTWKQKSHENQYLEAVND    351 - 420
FYAAKKTWDIELSDVAKDFSAISLACTKLTEDNKKLEIDINKITVKTNESIRKKSKYESEIKYLTIMKLK    421 - 490
NDKHLKNIYKEAYRIGTLFHLTKHKTDEMEDKIAEVRRKFKGREEFLKKLTQGEVAAGMVLQKKLYSIYE    491 - 560
VQALERKELIKNRAICAMSLAELQEPLLQLEDEAERIRSLDKEHSVMLNNIIDQKDLIRRKVGKVKKKLR    561 - 630
KKGKKTLDALIETESKRSAIFKDLEATKSKTMIFYAKINELNEELKAKEEEKKSFDQTLEILKNKFITMR    631 - 700
FKREHAQTVFDHYMQEKKDCEERIFEEDQRFRVLLAVRQKTLQDTQKIIADSLEENLRLAQEYQQLQITF    701 - 770
LKEKDNYFNIYDKQLSLDTSIRDKKQLCQLQRRMHTLWQEHFKLVVLFSQMRLANFQTDSQESIQKILAV    771 - 840
QEESSNLMQHILGFFQTLTDGTCENDG                                               841 - 867
//

Text Mined References (9)

PMID Year Title