Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.04
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.200 0.026
medulloblastoma, large-cell 1.300 0.001
lung carcinoma 1.400 0.000
ductal carcinoma in situ -1.600 0.000
invasive ductal carcinoma -2.200 0.000
ovarian cancer 1.300 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTENKTVSSSSTRDDQTNIGLTCQEVKALREKAWSRTNEGNAMSQSLVLYGASKENSEGFHESKMTNTEG      1 - 70
VNKGIYFSYPCRRHSCAVVNIPAPCVNKMISHIQDVESKIQEHLKRFETSFEEWSRTSSTKDLKEDWSVT     71 - 140
TPVKEVKPGEKRDEKCPELKQEMETLLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKL    141 - 210
QELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE    211 - 280
LQDLKNHYKKKMEVMDLHRKVNEELEEALEACENARLKAQQIKEEIDKDIYQDEKTIEAYKREIYQLNSL    281 - 350
FDHYSSSVINVNTNIEEKEEEVTEAIRETKSSKNELHSLSKMLEDLRRVYDQLTWKQKSHENQYLEAVND    351 - 420
FYAAKKTWDIELSDVAKDFSAISLACTKLTEDNKKLEIDINKITVKTNESIRKKSKYESEIKYLTIMKLK    421 - 490
NDKHLKNIYKEAYRIGTLFHLTKHKTDEMEDKIAEVRRKFKGREEFLKKLTQGEVAAGMVLQKKLYSIYE    491 - 560
VQALERKELIKNRAICAMSLAELQEPLLQLEDEAERIRSLDKEHSVMLNNIIDQKDLIRRKVGKVKKKLR    561 - 630
KKGKKTLDALIETESKRSAIFKDLEATKSKTMIFYAKINELNEELKAKEEEKKSFDQTLEILKNKFITMR    631 - 700
FKREHAQTVFDHYMQEKKDCEERIFEEDQRFRVLLAVRQKTLQDTQKIIADSLEENLRLAQEYQQLQITF    701 - 770
LKEKDNYFNIYDKQLSLDTSIRDKKQLCQLQRRMHTLWQEHFKLVVLFSQMRLANFQTDSQESIQKILAV    771 - 840
QEESSNLMQHILGFFQTLTDGTCENDG                                               841 - 867
//

Text Mined References (8)

PMID Year Title
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.