Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFL      1 - 70
VYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSG     71 - 140
FLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFL    141 - 210
PNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPA    211 - 280
IFQKKLKQKFE                                                               281 - 291
//

Text Mined References (12)

PMID Year Title