Property Summary

NCBI Gene PubMed Count 12
PubMed Score 315.10
PubTator Score 25.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAG      1 - 70
AAAGAAAGAAAGLAAGSGWRRAAGPGERGLEDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLG     71 - 140
GALGALGLLRP                                                               141 - 151
//

Text Mined References (14)

PMID Year Title