Property Summary

NCBI Gene PubMed Count 12
PubMed Score 300.65
PubTator Score 25.77

Knowledge Summary

Patent

No data available

Synonym

Accession Q5BIV9 Protein shadoo
Symbols SHO
SHADOO
bA108K14.1

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
24390475 Shadoo is degraded in Scrapie-infected rodents and cultured cells mediated by proteasome degradation after modification by ubiquitination.
21257747 a conserved physiological activity between PrP(C) and Sho to protect cells from stress-induced toxicity and suggests that Sho and PrP(C) might act on similar signaling pathways.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18805828 Association of a null allele of SPRN with variant Creutzfeldt-Jakob disease
18805828 Observational study of gene-disease association. (HuGE Navigator)
18778261 A novel solid phase technology for high- throughput synthesis of the SPRN gene is reported.

AA Sequence

MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAG      1 - 70
AAAGAAAGAAAGLAAGSGWRRAAGPGERGLEDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLG     71 - 140
GALGALGLLRP                                                               141 - 151
//

Text Mined References (14)

PMID Year Title
24390475 2014 Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.
21257747 2011 Conserved stress-protective activity between prion protein and Shadoo.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18805828 2008 Association of a null allele of SPRN with variant Creutzfeldt-Jakob disease.
18778261 2008 A novel solid phase technology for high-throughput gene synthesis.
17199895 2007 Comparative genomic analysis of prion genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342797 2004 Evolution of vertebrate genes related to prion and Shadoo proteins--clues from comparative genomic analysis.
More...