Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.94
PubTator Score 17.64

Knowledge Summary

Patent (17,275)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.3e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (13)

PMID Text
24925317 we demonstrate that mutation of TNNI3K, encoding a heart-specific kinase known to modulate murine cardiac conduction and myocardial function, underlies a familial syndrome of electrical and myopathic heart disease in humans.
24899531 using novel genetic animal models and newly developed small-molecule TNNI3K inhibitors, we demonstrated that TNNI3K-mediated IR injury occurs through impaired mitochondrial function and is in part dependent on p38 MAPK.
23085512 TNNI3K mediates cell signaling to modulate cardiac response to stress.
21314842 Results suggest that TNNI3K overexpression induces cardiomyocytes hypertrophy and accelerates hypertrophy in hypertrophic cardiomyocytes.
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20569525 The finding of a de novo mutation in TNNI3 (R204H) enabled a genetic diagnosis and counselling. We suggest that the previously reported overlap of functional and morphologic phenotypes in sarcomeric genes may also be a feature of TNNI3 mutations.
19925440 [review] TNNI3K is a novel cardiac troponin I-interacting kinase gene that may be involved in the development of cardiac hypertrophy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18552163 TNNI3K promotes cardiomyogenesis, enhances cardiac performance, and protects the myocardium from ischemic injury by suppressing p38/JNK-mediated apoptosis.
18205602 coexpression of AOP-1 inhibited TNNI3K kinase activity
17660584 TNNI3K exhibits dual-specific kinase activity and forms dimers or oligomers that may be necessary for its activation
12721663 cloning of TNNI3K which interacts specifically with cardiac troponin I; data suggest that TNNI3K is a cardiac-specific kinase and plays important roles in the cardiac system

AA Sequence

MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSL      1 - 70
LHLCCICGGKKSHIRTLMLKGLRPSRLTRNGFTALHLAVYKDNAELITSLLHSGADIQQVGYGGLTALHI     71 - 140
ATIAGHLEAADVLLQHGANVNIQDAVFFTPLHIAAYYGHEQVTRLLLKFGADVNVSGEVGDRPLHLASAK    141 - 210
GFLNIAKLLMEEGSKADVNAQDNEDHVPLHFCSRFGHHDIVKYLLQSDLEVQPHVVNIYGDTPLHLACYN    211 - 280
GKFEVAKEIIQISGTESLTKENIFSETAFHSACTYGKSIDLVKFLLDQNVININHQGRDGHTGLHSACYH    281 - 350
GHIRLVQFLLDNGADMNLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEYSQPG    351 - 420
GDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIK    421 - 490
RYRANTYCSKSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDL    491 - 560
QSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQSLDEDNMTKQPGNLRW    561 - 630
MAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISSLLIR    631 - 700
GWNACPEGRPEFSEVVMKLEECLCNIELMSPASSNSSGSLSPSSSSDCLVNRGGPGRSHVAALRSRFELE    701 - 770
YALNARSYAALSQSAGQYSSQGLSLEEMKRSLQYTPIDKYGYVSDPMSSMHFHSCRNSSSFEDSS         771 - 835
//

Text Mined References (29)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24925317 2014 TNNI3K mutation in familial syndrome of conduction system disease, atrial tachyarrhythmia and dilated cardiomyopathy.
24899531 2014 Troponin I-interacting protein kinase: a novel cardiac-specific kinase, emerging as a molecular target for the treatment of cardiac disease.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23369981 2013 TNNI3K is a novel mediator of myofilament function and phosphorylates cardiac troponin I.
23236294 2012 Dissection of a quantitative trait locus for PR interval duration identifies Tnni3k as a novel modulator of cardiac conduction.
23085512 2013 Overexpression of TNNI3K, a cardiac-specific MAPKKK, promotes cardiac dysfunction.
21314842 2011 Adenovirus-mediated overexpression of cardiac troponin I-interacting kinase promotes cardiomyocyte hypertrophy.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20569525 2010 Ventricular septal defect and restrictive cardiomyopathy in a paediatric TNNI3 mutation carrier.
19925440 2009 TNNI3K could be a novel molecular target for the treatment of cardiac diseases.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19359327 2009 Upregulated expression of cardiac ankyrin repeat protein in human failing hearts due to arrhythmogenic right ventricular cardiomyopathy.
18552163 2008 Overexpression of TNNI3K, a cardiac-specific MAP kinase, promotes P19CL6-derived cardiac myogenesis and prevents myocardial infarction-induced injury.
18205602 2007 AOP-1 interacts with cardiac-specific protein kinase TNNI3K and down-regulates its kinase activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17660584 2007 Identification of the dual specificity and the functional domains of the cardiac-specific protein kinase TNNI3K.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12721663 2003 Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.