Property Summary

NCBI Gene PubMed Count 1
PubMed Score 18.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lacrimal gland carcinoma 5 4.404 2.2

Synonym

Accession Q59GN2
Symbols RPL39_7_406

Gene

AA Sequence

MSSHKTFKIKQFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWKRTKLGL                         1 - 51
//

Text Mined References (1)

PMID Year Title
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.