Property Summary

NCBI Gene PubMed Count 17
PubMed Score 54.72
PubTator Score 15.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 3.2e-02
astrocytic glioma -1.500 6.5e-03
atypical teratoid / rhabdoid tumor -1.700 3.0e-06
ependymoma -1.200 1.5e-02
glioblastoma -1.700 2.5e-06
group 4 medulloblastoma -1.500 9.3e-03
intraductal papillary-mucinous adenoma (... 1.400 2.6e-05
medulloblastoma, large-cell -2.100 3.2e-05
oligodendroglioma -1.400 8.1e-17
ovarian cancer -1.300 2.0e-04
primitive neuroectodermal tumor -1.800 5.8e-05

Synonym

Accession Q58WW2 A2A295 B4DNB8 Q7L8I0 Q8IXH3 Q8TB19
Symbols NRIP
ARCAP
IQWD1
PC326
MSTP055
1200006M05Rik

Gene

PANTHER Protein Class (2)

PDB

3I7O  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGS      1 - 70
DDTKLVISNPYSRKVLTTIRSGHRANIFSAKFLPCTNDKQIVSCSGDGVIFYTNVEQDAETNRQCQFTCH     71 - 140
YGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPIPYYLAVG    141 - 210
CSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNNKSCRVTSLCYSEDGQEILVSYSSDYIYLF    211 - 280
DPKDDTARELKTPSAEERREELRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLS    281 - 350
RWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQ    351 - 420
AHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTST    421 - 490
IKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPV    491 - 560
ENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQ    561 - 630
FQTEATGPSAHEETSTRDSALQDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRKERKEMEELD    631 - 700
TLNIRRPLVKMVYKGHRNSRTMIKEANFWGANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPH    701 - 770
PFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRAD    771 - 840
RLEGDRSEGSGQENENEDEE                                                      841 - 860
//

Text Mined References (26)

PMID Year Title