Property Summary

NCBI Gene PubMed Count 14
Grant Count 21
R01 Count 8
Funding $1,698,474.77
PubMed Score 53.58
PubTator Score 15.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.500 0.006
ependymoma -1.200 0.015
glioblastoma -1.700 0.000
oligodendroglioma -1.400 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.800 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.000
adult high grade glioma -1.300 0.032
ovarian cancer 1.700 0.003

Gene RIF (7)

PMID Text
24222117 High IQWD1 expression is associated with breast cancer.
22177699 NRIP enhances HPV 16 gene expression via interaction with either GR or viral E2.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
18673574 A survey results showed that ten cancer cases were revealed to express the NRIP in six malignancies, but not all of these specific tumor types consistently showed positive NRIP expression.
17984071 NRIP plays a feed-forward role enhancing androgen receptor (AR)-driven NRIP promoter activity via NRIP forming a complex with AR to protect AR protein from proteasome degradation.
15784617 NRIP interacts with either androgen or glucocorticoid receptors

AA Sequence

MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGS      1 - 70
DDTKLVISNPYSRKVLTTIRSGHRANIFSAKFLPCTNDKQIVSCSGDGVIFYTNVEQDAETNRQCQFTCH     71 - 140
YGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPIPYYLAVG    141 - 210
CSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNNKSCRVTSLCYSEDGQEILVSYSSDYIYLF    211 - 280
DPKDDTARELKTPSAEERREELRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLS    281 - 350
RWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQ    351 - 420
AHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTST    421 - 490
IKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPV    491 - 560
ENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQ    561 - 630
FQTEATGPSAHEETSTRDSALQDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRKERKEMEELD    631 - 700
TLNIRRPLVKMVYKGHRNSRTMIKEANFWGANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPH    701 - 770
PFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRAD    771 - 840
RLEGDRSEGSGQENENEDEE                                                      841 - 860
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222117 2013 Identification of androgen-responsive microRNAs and androgen-related genes in breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22177699 2012 NRIP enhances HPV gene expression via interaction with either GR or E2.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18673574 2008 Nuclear Receptor Interaction Protein (NRIP) expression assay using human tissue microarray and immunohistochemistry technology confirming nuclear localization.
More...