Property Summary

NCBI Gene PubMed Count 4
PubMed Score 37.56
PubTator Score 16.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.6e-09
osteosarcoma 7950 2.9e-06
Disease Target Count Z-score Confidence
Neutral lipid storage disease 12 3.723 1.9
Fatty liver disease 103 3.295 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.050 2.9e-06
psoriasis -2.000 3.6e-09

Gene RIF (1)

AA Sequence

MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVR      1 - 70
NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWF     71 - 140
FKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQH    141 - 210
GAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGE    211 - 280
PLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL                          281 - 328
//

Text Mined References (5)

PMID Year Title