Property Summary

NCBI Gene PubMed Count 4
Grant Count 5
R01 Count 5
Funding $552,616.33
PubMed Score 33.20
PubTator Score 16.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.050 0.000
psoriasis -2.000 0.000

Synonym

Accession Q58HT5 Q5JT21 Q6IEE4
Symbols DGA2
DGAT2L3

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
15671038 analysis of AWAT1 and AWAT2 substrate specificity and differentiation-specific expression pattern

AA Sequence

MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVR      1 - 70
NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWF     71 - 140
FKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQH    141 - 210
GAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGE    211 - 280
PLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL                          281 - 328
//

Text Mined References (5)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15671038 2005 Identification of two novel human acyl-CoA wax alcohol acyltransferases: members of the diacylglycerol acyltransferase 2 (DGAT2) gene superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.