Property Summary

NCBI Gene PubMed Count 4
PubMed Score 33.20
PubTator Score 16.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.599364104139E-9
osteosarcoma 7933 2.87154883643465E-6
Disease Target Count Z-score Confidence
Neutral lipid storage disease 14 3.713 1.9
Fatty liver disease 86 3.188 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.050 0.000
psoriasis -2.000 0.000

Synonym

Accession Q58HT5 Q5JT21 Q6IEE4
Symbols DGA2
DGAT2L3

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Gene RIF (1)

PMID Text
15671038 analysis of AWAT1 and AWAT2 substrate specificity and differentiation-specific expression pattern

AA Sequence

MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVR      1 - 70
NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWF     71 - 140
FKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQH    141 - 210
GAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGE    211 - 280
PLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL                          281 - 328
//

Text Mined References (5)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15671038 2005 Identification of two novel human acyl-CoA wax alcohol acyltransferases: members of the diacylglycerol acyltransferase 2 (DGAT2) gene superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.