Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
23999003 SYT14L, especially its C2 domain, may play an important role in the regulation of dendricity in melanocytes.
16376304 Genomic analyses suggest that human sytdep could derive from a retrotranslocation of a synaptotagmin XIV transcript into chromosome 4.

AA Sequence

MLEGFQILVQNTVQGTIHKIKCVCDSQMSVSEMSCSESTSACQSLEDGSVPEILISLLYNATNGRLSAEV      1 - 70
IKGSHLKNWAANRPPNTYVKLTLRKSTDQEMSKCKISIRRGRPNPVYKETFVFKVTLFQLSHVTLMLSVY     71 - 140
NKSSMRRKMIGWIYLGLNSSGEELNHWTEMKESKGRQVRRWQALLESR                          141 - 188
//

Text Mined References (8)

PMID Year Title
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
16376304 2006 Cloning and genomic characterization of sytdep, a new synaptotagmin XIV-related gene.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15238157 2004 Synaptotagmin gene content of the sequenced genomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543631 2001 Genomic analysis of synaptotagmin genes.