Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MLEGFQILVQNTVQGTIHKIKCVCDSQMSVSEMSCSESTSACQSLEDGSVPEILISLLYNATNGRLSAEV      1 - 70
IKGSHLKNWAANRPPNTYVKLTLRKSTDQEMSKCKISIRRGRPNPVYKETFVFKVTLFQLSHVTLMLSVY     71 - 140
NKSSMRRKMIGWIYLGLNSSGEELNHWTEMKESKGRQVRRWQALLESR                          141 - 188
//

Text Mined References (8)

PMID Year Title