Property Summary

NCBI Gene PubMed Count 3
PubMed Score 4395.51
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Synonym

Accession Q58FG1
Symbols HSP90Ad
HSPCAL2

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Component (1)

AA Sequence

MESLTDPSKLDSGKEPHISLIPNKQDRTLTIVDTGIGMTKADLINNLGTITKSETKVFMEVLQAGADISM      1 - 70
IGQFSVGFYSAYSVAEKVTVITKHNNDEQYAWESSLRGSFTEYREFYKSLTINWEDYLAVKHFSVEGQLE     71 - 140
FRAFLFVPRLAPFELLETRKKKNKIKLSARRDLIMDNCEELIPEYLNFIRGVVDSEDLPLNIFRETKDQV    141 - 210
ANSTIVQRLWKHGLEVIYTIEPIDEYCVQQLKEFEGKTLVSVTKEDLELPEDEEEKKKQEEGKQKTKQKK    211 - 280
NQSLRTSAKSTYGWTANMERIMKAQALRDNSTTGYMAAKKHLEINPDHSFIDTLRQKAETDKNDKSVKDL    281 - 350
VILLYETALLSSDFGLEGPQTHANRIYRMNKLGLGTDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEK      351 - 418
//

Text Mined References (3)

PMID Year Title
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.
9847074 1998 Toward a complete human genome sequence.
1740332 1992 Mapping of the gene family for human heat-shock protein 90 alpha to chromosomes 1, 4, 11, and 14.