Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
inflammatory breast cancer 286 3.5e-02

Expression

Gene RIF (1)

AA Sequence

MGFHHVGQAGLELLTSGHPALERRPEYLEERRIKEIVKKHSQFIGYPITLFVEKKRNKQVSDAEAEKKED      1 - 70
KRKKKKESNDKPEIEDVGSDEEEEKKDADKKKKKSKEKYIDQELNKTKPIWTRNPDAITNEEYGEFHQSL     71 - 140
TNNWEDHLAVKHFSVEGQLEELKDSRRVMKANQKHIYYITGETKDQVANSAFVECLQKHGLEVIYMIELI    141 - 210
DKYCVQQLKELESKTVVSVAKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDMLEKKVKKVVVSNCMEDP    211 - 280
QRHTNKIYRMIKLGLGVDEYDPTANDINAAITKEMPPLRGGDDTSRMEEVGGSG                    281 - 334
//

Text Mined References (3)

PMID Year Title