Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
inflammatory breast cancer 404

Expression

Gene RIF (1)

PMID Text
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.

AA Sequence

MGFHHVGQAGLELLTSGHPALERRPEYLEERRIKEIVKKHSQFIGYPITLFVEKKRNKQVSDAEAEKKED      1 - 70
KRKKKKESNDKPEIEDVGSDEEEEKKDADKKKKKSKEKYIDQELNKTKPIWTRNPDAITNEEYGEFHQSL     71 - 140
TNNWEDHLAVKHFSVEGQLEELKDSRRVMKANQKHIYYITGETKDQVANSAFVECLQKHGLEVIYMIELI    141 - 210
DKYCVQQLKELESKTVVSVAKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDMLEKKVKKVVVSNCMEDP    211 - 280
QRHTNKIYRMIKLGLGVDEYDPTANDINAAITKEMPPLRGGDDTSRMEEVGGSG                    281 - 334
//

Text Mined References (3)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.