Property Summary

NCBI Gene PubMed Count 6
PubMed Score 173.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 3.755 1.9

Gene RIF (1)

AA Sequence

MPEEVHLGEKEVETFAFQAEIAQLMSLIINTFYSNKEIFLWELISNASDALDKIRYESLTDPSKLDSGKE      1 - 70
LKIDIIPNTQEHTLTLVDTGIGMTKADLINNLGTIAKFQDQTEYLEEMQVKEVVEKHSQFLGYPITLYLE     71 - 140
KEREKEISDGKAEEEKGEKEEENKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPI    141 - 210
WTRNTEDITQEEYGEFYKSLTNDWKDHLAVRYFSVEEYVSRMKEIQKSIYYITGESKEQVANSAFVEQVW    211 - 280
KRDSRVVYMTEPIDGYQLKEFDGKSLVSVTKEGLELPEDGEEKKRMEERKAKFENLCKFMKETLDKKVEM    281 - 350
VTVSNRLVSSSCCIVTSTYSWTANMEQIMKA                                           351 - 381
//

Text Mined References (7)

PMID Year Title