Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MPEEVHHGEEEVETFAFQAEIAQLISLIINTFYSNEEIFLQELISNASDALDKIRYESLTDPSKLDSGKE      1 - 70
LKIDIIPNPQERTLALVDTGIGMTKADLINNLRTIAKSGTKACMEALQAEKLVVITKHNDDEQYAWESSA     71 - 140
GGSFTVHADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEQDKEISDDEAE    141 - 210
EEKGEKEEEDKDDEEKPKIKDVGSDEEDDSKEYGEFYKSLTSDWEDHLAVKHFSVEGQLEFRALLFSPRR    211 - 280
APFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIHGVVDSEDLPLNISREMLQQSKILKYVSHMK    281 - 350
ETQKSTYYITGESKEQVANSAFVERVRKQGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDE    351 - 420
EEKKKMEESKEKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMEQIMKAQALRDNSTM    421 - 490
GYMMAKKHLEINPDHPIMETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNHIYHMIKLG    491 - 560
LGTDEDEVAAEEPSDAVPDEIPPLEGDEDASRMEEVD                                     561 - 597
//

Text Mined References (6)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.
9847074 1998 Toward a complete human genome sequence.
8288256 1993 Assignment of an intron-containing human heat-shock protein gene (hsp90 beta, HSPCB) to chromosome 6 near TCTE1 (6p21) and two intronless pseudogenes to chromosomes 4 and 15 by polymerase chain reaction amplification from a panel of hybrid cell lines.