Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q58FF6
Symbols HSP90Bd

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MSLIINTFYSNKEIFLQELISNASDALDKIRYESLTDPSKLDGGKELKIDIIPNPRECILTLVNTGIGMT      1 - 70
KADLINNLGAIAKSGTEAFMEAFQSCAEISMIGQFGVGFYSAYLVAEKVAITKHNDEEQYSWVSSAGSSF     71 - 140
TLHVDHGEPIDRDTKVILHLKEDQTEYLEERWVKEVVKKHPQFIGCLIAVYLEKEPEKEISDDEEEKGEK    141 - 210
EEEDKDDKEKPKTEDVGSDEEDDTDKNNKKKTKKIKEKYTDREELNQTKPIWTRNPDDITQEECGEFYKS    211 - 280
LTSAWEDHLAVKQFPVEEQEENEQLCVHHVWIMDSFDDLMPEYVGFVREDKENNKKLDEVFSKISWLGIH    281 - 350
EDSINWRHLSELLWSHTFQSGDEMTSLSEYVSCMKEAQKSICDIIGECKEQVANSAFVEQEWKKGFEVIY    351 - 420
MSEPIDEYCVQQLKEFDGKSLLSVTKEGLELPEDEEEKKIMEESNVKFENLCRLMKEILDKKVERVTISS    421 - 490
RLVSSPCRIVTSTYS                                                           491 - 505
//

Text Mined References (3)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.