Property Summary

NCBI Gene PubMed Count 17
Grant Count 12
R01 Count 8
Funding $857,224.58
PubMed Score 56.86
PubTator Score 31.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 4.400 0.000
facioscapulohumeral dystrophy 3.700 0.000

Gene RIF (8)

PMID Text
25374327 considered potential associations of 14 single nucleotide polymorphisms (SNPs) in RNF8 and BRDT genes in Chinese patients with non-obstructive azoospermia
24865796 assessment of rs3088232 frequency in large group of non-obstructive azoospermia men and fertile controls demonstrated no significant difference between them; conclude that testicular impairments observed were not a consequence of BRDT gene mutation
22035730 In human, BRDT is the only BET gene expressed exclusively in testicular germ cells.
20538714 Suggest that reduced histone methylation in the promoter of BRDT may be associated with increased transcript levels in subfertile patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of bromodomain, testis-specific (BRDT) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15647849 BRDT-NY gene is an alternatively spliced variant that may have an important role in the process of spermatogenesis and may be correlated with male infertility

AA Sequence

MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTII      1 - 70
KNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEEQVV     71 - 140
GVKERIKKGTQQNIAVSSAKEKSSPSATEKVFKQQEIPSVFPKTSISPLNVVQGASVNSSSQTAAQVTKG    141 - 210
VKRKADTTTPATSAVKASSEFSPTFTEKSVALPPIKENMPKNVLPDSQQQYNVVKTVKVTEQLRHCSEIL    211 - 280
KEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYK    281 - 350
YNPPDHEVVTMARMLQDVFETHFSKIPIEPVESMPLCYIKTDITETTGRENTNEASSEGNSSDDSEDERV    351 - 420
KRLAKLQEQLKAVHQQLQVLSQVPFRKLNKKKEKSKKEKKKEKVNNSNENPRKMCEQMRLKEKSKRNQPK    421 - 490
KRKQQFIGLKSEDEDNAKPMNYDEKRQLSLNINKLPGDKLGRVVHIIQSREPSLSNSNPDEIEIDFETLK    491 - 560
ASTLRELEKYVSACLRKRPLKPPAKKIMMSKEELHSQKKQELEKRLLDVNNQLNSRKRQTKSDKTQPSKA    561 - 630
VENVSRLSESSSSSSSSSESESSSSDLSSSDSSDSESEMFPKFTEVKPNDSPSKENVKKMKNECIPPEGR    631 - 700
TGVTQIGYCVQDTTSANTTLVHQTTPSHVMPPNHHQLAFNYQELEHLQTVKNISPLQILPPSGDSEQLSN    701 - 770
GITVMHPSGDSDTTMLESECQAPVQKDIKIKNADSWKSLGKPVKPSGVMKSSDELFNQFRKAAIEKEVKA    771 - 840
RTQELIRKHLEQNTKELKASQENQRDLGNGLTVESFSNKIQNKCSGEEQKEHQQSSEAQDKSKLWLLKDR    841 - 910
DLARQKEQERRRREAMVGTIDMTLQSDIMTMFENNFD                                     911 - 947
//

Text Mined References (22)

PMID Year Title
25374327 2015 Genetic association study of RNF8 and BRDT variants with non-obstructive azoospermia in the Chinese Han population.
24865796 2014 BRDT gene sequence in human testicular pathologies and the implication of its single nucleotide polymorphism (rs3088232) on fertility.
22971749 2012 The conserved 12-amino acid stretch in the inter-bromodomain region of BET family proteins functions as a nuclear localization signal.
22901802 2012 Small-molecule inhibition of BRDT for male contraception.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
22035730 2012 Expression of BET genes in testis of men with different spermatogenic impairments.
20538714 2010 The interaction of modified histones with the bromodomain testis-specific (BRDT) gene and its mRNA level in sperm of fertile donors and subfertile men.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...