Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.08
PubTator Score 3.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.600 4.2e-07
interstitial cystitis -2.000 1.8e-03
lung adenocarcinoma 1.300 4.4e-11
osteosarcoma -1.172 1.6e-02
ovarian cancer -1.700 1.1e-04
Pilocytic astrocytoma 1.100 1.9e-04

Protein-protein Interaction (6)

Gene RIF (3)

AA Sequence

MGENEASLPNTSLQGKKMAYQKVHADQRAPGHSQYLDNDDLQATALDLEWDMEKELEESGFDQFQLDGAE      1 - 70
NQNLGHSETIDLNLDSIQPATSPKGRFQRLQEESDYITHYTRSAPKSNRCNFCHVLKILCTATILFIFGI     71 - 140
LIGYYVHTNCPSDAPSSGTVDPQLYQEILKTIQAEDIKKSFRNLVQLYKNEDDMEISKKIKTQWTSLGLE    141 - 210
DVQFVNYSVLLDLPGPSPSTVTLSSSGQCFHPNGQPCSEEARKDSSQDLLYSYAAYSAKGTLKAEVIDVS    211 - 280
YGMADDLKRIRKIKNVTNQIALLKLGKLPLLYKLSSLEKAGFGGVLLYIDPCDLPKTVNPSHDTFMVSLN    281 - 350
PGGDPSTPGYPSVDESFRQSRSNLTSLLVQPISAPLVAKLISSPKARTKNEACSSLELPNNEIRVVSMQV    351 - 420
QTVTKLKTVTNVVGFVMGLTSPDRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMSKVKRGWRPDRT    421 - 490
IVFCSWGGTAFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLYPVASPSLQQLVVEKNNFNCTRR    491 - 560
AQCPETNISSIQIQGDADYFINHLGVPIVQFAYEDIKTLEGPSFLSEARFSTRATKIEEMDPSFNLHETI    561 - 630
TKLSGEVILQIANEPVLPFNALDIALEVQNNLKGDQPNTHQLLAMALRLRESAELFQSDEMRPANDPKER    631 - 700
APIRIRMLNDILQDMEKSFLVKQAPPGFYRNILYHLDEKTSRFSILIEAWEHCKPLASNETLQEALSEVL    701 - 770
NSINSAQVYFKAGLDVFKSVLDGKN                                                 771 - 795
//

Text Mined References (17)

PMID Year Title