Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.87
PubTator Score 8.70

Knowledge Summary

Patent (1,945)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.295 7.2e-06
ependymoma 1.500 3.9e-02
juvenile dermatomyositis 1.574 1.1e-12
osteosarcoma -1.168 9.7e-04
ovarian cancer -1.400 3.9e-05
pancreatic cancer 1.200 3.0e-03
primary pancreatic ductal adenocarcinoma 1.221 3.7e-03

Gene RIF (3)

AA Sequence

MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFYGEECQFLHED      1 - 70
PAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLGDPGTGAAAGGGGSSGGLDGP     71 - 140
RLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLT    141 - 210
SPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTE    211 - 280
NNLQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKIT    281 - 350
PHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN    351 - 420
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPP    421 - 490
PNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAF    491 - 560
AEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRT    561 - 630
IHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACN    631 - 700
SLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEED    701 - 770
LAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN    771 - 840
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL                           841 - 887
//

Text Mined References (20)

PMID Year Title