Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MWILSNLMGTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGF      1 - 70
PIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP                                      71 - 107
//

Text Mined References (6)

PMID Year Title