Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
15930275 PCOTH is involved in growth and survival of prostate cancer cells thorough, in parts, the TAF-Ibeta pathway.

AA Sequence

MWILSNLMGTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGF      1 - 70
PIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP                                      71 - 107
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21640322 2011 Genetic variants at 13q12.12 are associated with high myopia in the Han Chinese population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15930275 2005 PCOTH, a novel gene overexpressed in prostate cancers, promotes prostate cancer cell growth through phosphorylation of oncoprotein TAF-Ibeta/SET.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.