Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.55
PubTator Score 12.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hydatidiform Mole 2 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 1.3e-02

Gene RIF (11)

AA Sequence

MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMS      1 - 70
QILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEV     71 - 140
REAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDA    141 - 210
RDPVTRL                                                                   211 - 217
//

Text Mined References (15)

PMID Year Title