Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 5.5e-10
ependymoma 1.100 8.2e-09
intraductal papillary-mucinous neoplasm ... 1.200 6.0e-03
medulloblastoma 1.100 2.7e-08
medulloblastoma, large-cell 1.100 4.2e-05
primitive neuroectodermal tumor 1.300 3.5e-05

AA Sequence

MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAESAAAGLTCLPS      1 - 70
VTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALALAGSALLRGGAACGRLLRCEE     71 - 140
APSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAALLAALVGLLPWGGGTALRLALGRLGRGAGLA    141 - 210
KVLPV                                                                     211 - 215
//

Text Mined References (4)

PMID Year Title