Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.08

Knowledge Summary

Patent

No data available

AA Sequence

MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAESAAAGLTCLPS      1 - 70
VTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALALAGSALLRGGAACGRLLRCEE     71 - 140
APSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAALLAALVGLLPWGGGTALRLALGRLGRGAGLA    141 - 210
KVLPV                                                                     211 - 215
//

Text Mined References (4)

PMID Year Title
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.