Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.51
PubTator Score 4.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24949437 it well explained the mechanism of TGFbeta induced OCIAD2 expression in cancer microenvironment, therefore providing an important clue for the future functional analysis of OCIAD2 in tumor pathogenesis.
24270855 OCIAD2 also increased the interaction of nicastrin with C99 and stimulated APP processing via gamma-secretase activation, but did not affect Notch processing
22726067 Like OCIAD1, OCIAD2 is a cancer-related protein and its expression level increases during the course of malignant progression and is thought to be a very useful marker for evaluating the malignancy of ovarian mucinous tumors.

AA Sequence

MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLV      1 - 70
YQGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIK     71 - 140
HGLSEKGDSQPSAS                                                            141 - 154
//

Text Mined References (12)

PMID Year Title
24949437 2014 Pathway bridge based multiobjective optimization approach for lurking pathway prediction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270855 2014 OCIAD2 activates ?-secretase to enhance amyloid ? production by interacting with nicastrin.
22726067 2012 Increased expression of OCIA domain containing 2 during stepwise progression of ovarian mucinous tumor.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17054434 2007 OCIA domain containing 2 is highly expressed in adenocarcinoma mixed subtype with bronchioloalveolar carcinoma component and is associated with better prognosis.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...