Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.31
PubTator Score 4.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (4)

AA Sequence

MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLV      1 - 70
YQGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIK     71 - 140
HGLSEKGDSQPSAS                                                            141 - 154
//

Text Mined References (13)

PMID Year Title