Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.51
PubTator Score 4.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 4.0179390510163E-26
lung carcinoma 2844 4.8170888978886E-18
lung adenocarcinoma 2714 9.66274638571769E-17
pancreatic cancer 2300 9.3732667328496E-7
cystic fibrosis 1670 7.45732509927861E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.05680508626591E-5
group 3 medulloblastoma 2254 1.04888579133572E-4
ovarian cancer 8492 3.96619276634288E-4
medulloblastoma, large-cell 6234 6.6633038722791E-4
ductal carcinoma in situ 1745 9.77619969073472E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.86234353536289E-4
adult high grade glioma 2148 0.00116772142415234
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00202812054160422
astrocytic glioma 2241 0.00256061056829489
primary pancreatic ductal adenocarcinoma 1271 0.00267689340408436
invasive ductal carcinoma 2950 0.00378032800324877
glioblastoma 5572 0.0107212818725519
oligodendroglioma 2849 0.0107318230568185
osteosarcoma 7933 0.0110194998780354
subependymal giant cell astrocytoma 2287 0.0227635214103255
Disease Target Count Z-score Confidence
Ovarian mucinous neoplasm 1 4.684 2.3
Brain glioma 10 3.035 1.5

Expression

Synonym

Accession Q56VL3 B4DPE7 Q8N544
Symbols

Gene

  Ortholog (9)

Gene RIF (3)

PMID Text
24949437 it well explained the mechanism of TGFbeta induced OCIAD2 expression in cancer microenvironment, therefore providing an important clue for the future functional analysis of OCIAD2 in tumor pathogenesis.
24270855 OCIAD2 also increased the interaction of nicastrin with C99 and stimulated APP processing via gamma-secretase activation, but did not affect Notch processing
22726067 Like OCIAD1, OCIAD2 is a cancer-related protein and its expression level increases during the course of malignant progression and is thought to be a very useful marker for evaluating the malignancy of ovarian mucinous tumors.

AA Sequence

MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLV      1 - 70
YQGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIK     71 - 140
HGLSEKGDSQPSAS                                                            141 - 154
//

Text Mined References (12)

PMID Year Title
24949437 2014 Pathway bridge based multiobjective optimization approach for lurking pathway prediction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270855 2014 OCIAD2 activates ?-secretase to enhance amyloid ? production by interacting with nicastrin.
22726067 2012 Increased expression of OCIA domain containing 2 during stepwise progression of ovarian mucinous tumor.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17054434 2007 OCIA domain containing 2 is highly expressed in adenocarcinoma mixed subtype with bronchioloalveolar carcinoma component and is associated with better prognosis.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...