Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.54
PubTator Score 17.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 2.231 0.001
ulcerative colitis -1.400 0.000
ovarian cancer 2.400 0.000

Gene RIF (4)

PMID Text
23542036 Independently of EAPP, E2F1 also increases the activity of the MDR1 promoter.
21258403 results indicate that the level of EAPP is critical for cellular homeostasis
18588995 Regulation of the EAPP promoter by GC-box binding proteins is reported.
15716352 EAPP modulates E2F-regulated transcription, stimulates proliferation, and may be involved in the malignant transformation of cells.

AA Sequence

MNRLPDDYDPYAVEEPSDEEPALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELN      1 - 70
STMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYD     71 - 140
PEKDNRDQAWVDAQRRGYHGLGPQRSRQQQPVPNSDAVLNCPACMTTLCLDCQRHESYKTQYRAMFVMNC    141 - 210
SINKEEVLRYKASENRKKRRVHKKMRSNREDAAEKAETDVEEIYHPVMCTECSTEVAVYDKDEVFHFFNV    211 - 280
LASHS                                                                     281 - 285
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23542036 2013 Regulation of the MDR1 promoter by E2F1 and EAPP.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21258403 2011 EAPP: gatekeeper at the crossroad of apoptosis and p21-mediated cell-cycle arrest.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18588995 2008 Regulation of the E2F-associated phosphoprotein promoter by GC-box binding proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...