Property Summary

NCBI Gene PubMed Count 16
PubMed Score 32.37
PubTator Score 17.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ulcerative colitis 1819 5.8e-08
ovarian cancer 8520 3.5e-05
Multiple myeloma 1332 5.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
farmer's lung 2 3.879 1.9
Holoprosencephaly 56 3.379 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 2.231 5.5e-04
ovarian cancer -1.500 3.5e-05
ulcerative colitis -1.400 5.8e-08

Synonym

Accession Q56P03 Q9BVF4 Q9NWV5 Q9NZ86 EAPP
Symbols BM036
C14orf11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MNRLPDDYDPYAVEEPSDEEPALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELN      1 - 70
STMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYD     71 - 140
PEKDNRDQAWVDAQRRGYHGLGPQRSRQQQPVPNSDAVLNCPACMTTLCLDCQRHESYKTQYRAMFVMNC    141 - 210
SINKEEVLRYKASENRKKRRVHKKMRSNREDAAEKAETDVEEIYHPVMCTECSTEVAVYDKDEVFHFFNV    211 - 280
LASHS                                                                     281 - 285
//

Text Mined References (22)

PMID Year Title