Property Summary

NCBI Gene PubMed Count 21
PubMed Score 257.23
PubTator Score 68.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.063 3.1e-02
adult high grade glioma 1.300 1.2e-03
glioblastoma 1.100 4.9e-04
group 3 medulloblastoma 1.400 1.7e-04
intraductal papillary-mucinous carcinoma... 1.200 1.0e-02
medulloblastoma, large-cell 2.100 6.5e-05
nasopharyngeal carcinoma 1.600 4.6e-04
non primary Sjogren syndrome sicca -1.100 3.5e-02
non-small cell lung carcinoma 1.500 1.0e-17
osteosarcoma -2.143 3.3e-05
ovarian cancer 1.900 6.7e-05
primitive neuroectodermal tumor 1.200 9.2e-03
psoriasis 1.700 3.9e-70

Gene RIF (14)

AA Sequence

MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPS      1 - 70
ANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKP     71 - 140
QKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAA    141 - 210
FFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSK    211 - 280
NKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSV    281 - 350
NFMKQTNIQKNTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKY    351 - 420
VGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFLFISDEKRVVG    421 - 490
CLIAEPIKQAFRVLSEPIGPESPSSTECPRAWQCSDVPEPAVCGISRIWVFRLKRRKRIARRLVDTLRNC    491 - 560
FMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS                                 561 - 601
//

Text Mined References (28)

PMID Year Title