Property Summary

NCBI Gene PubMed Count 3
PubMed Score 4.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q56A73 B3KX90 Q5JUL2
Symbols TDRD28

Gene

PDB

4UY4  

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVK      1 - 70
PTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGM     71 - 140
VLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKD    141 - 210
DGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP                                   211 - 249
//

Text Mined References (5)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.