Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.54
PubTator Score 6.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -2.900 9.1e-04
aldosterone-producing adenoma -1.370 2.7e-02
astrocytic glioma -2.800 6.4e-03
Astrocytoma, Pilocytic -2.500 1.4e-03
atypical teratoid / rhabdoid tumor -1.800 4.8e-02
ependymoma -3.200 8.7e-03
gastric carcinoma -3.500 8.0e-03
glioblastoma -3.200 1.1e-08
group 4 medulloblastoma -2.500 2.2e-02
interstitial cystitis -1.200 4.3e-03
invasive ductal carcinoma -1.100 4.0e-02
lung adenocarcinoma -1.500 7.9e-08
lung carcinoma -2.500 4.0e-20
medulloblastoma, large-cell -2.700 1.5e-02
non-small cell lung cancer -3.344 1.1e-24
oligodendroglioma -2.600 1.4e-02
osteosarcoma 2.128 3.2e-02
ovarian cancer -1.300 4.0e-08
Pick disease -1.300 1.0e-02
pituitary cancer 1.300 5.6e-04
primitive neuroectodermal tumor -3.700 2.7e-05
psoriasis -1.200 3.7e-15
subependymal giant cell astrocytoma -3.594 1.4e-03

Gene RIF (8)

AA Sequence

MNMANFLRGFEEKGIKNDRPEDQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRKRVKQLSDGQP      1 - 70
PPPAQASPSSNSSTGSTCHTTTLPALVRTPTLMMQPSLDIKPFMSFPVDSSSAVGLFPNFNTMDPVQKAV     71 - 140
INHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSKHAKKVKALDATKNKPKMVPSKDSAKANPSC    141 - 210
SITPITGNNSDKSEDKGKLKASSSSQPSSSESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEK    211 - 280
AKKLLYCSLCKVAVNSLSQLEAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHC    281 - 350
EICDVHVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSP    351 - 420
LAAAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY                       421 - 471
//

Text Mined References (14)

PMID Year Title