Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.36
PubTator Score 6.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.68959132972299E-26
lung carcinoma 2844 3.95076647252919E-20
posterior fossa group A ependymoma 1511 1.69709994554074E-16
psoriasis 6685 3.66057948341131E-15
ovarian cancer 8492 3.98395225482779E-8
lung adenocarcinoma 2714 7.87783146011725E-8
glioblastoma 5572 2.27242450530609E-6
primitive neuroectodermal tumor 3031 3.35845023011797E-5
adult high grade glioma 2148 1.15169362249474E-4
pilocytic astrocytoma 3086 1.61294575320181E-4
sonic hedgehog group medulloblastoma 1482 3.80143965763949E-4
astrocytic glioma 2241 0.00121851799475587
pituitary cancer 1972 0.00140663388784039
subependymal giant cell astrocytoma 2287 0.00143819175721115
interstitial cystitis 2299 0.00433864807945514
gastric carcinoma 832 0.006282533021637
medulloblastoma, large-cell 6234 0.00707104351502136
Pick disease 1893 0.00997911256316887
oligodendroglioma 2849 0.0141475927458803
atypical teratoid / rhabdoid tumor 4369 0.0154497997460112
invasive ductal carcinoma 2950 0.0173348697971857
aldosterone-producing adenoma 664 0.0269708694449459
osteosarcoma 7933 0.0322101692339039
Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0
Vitiligo 71 0.0 1.0
Disease Target Count Z-score Confidence
CHARGE syndrome 23 3.233 1.6
Cleft Lip 91 3.017 1.5

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -2.900 0.001
posterior fossa group A ependymoma -4.400 0.000
oligodendroglioma -2.600 0.014
glioblastoma -4.200 0.000
osteosarcoma 2.128 0.032
sonic hedgehog group medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -2.500 0.015
medulloblastoma, large-cell -3.100 0.007
primitive neuroectodermal tumor -4.100 0.000
non-small cell lung cancer -3.430 0.000
interstitial cystitis -1.200 0.004
lung adenocarcinoma -1.500 0.000
adult high grade glioma -3.500 0.000
pilocytic astrocytoma -3.000 0.000
aldosterone-producing adenoma -1.370 0.027
subependymal giant cell astrocytoma -3.594 0.001
lung carcinoma -2.500 0.000
Pick disease -1.300 0.010
gastric carcinoma -3.600 0.006
invasive ductal carcinoma -1.300 0.017
ovarian cancer -1.300 0.000
pituitary cancer 1.400 0.001
psoriasis -1.200 0.000

Synonym

Accession Q569K4 Q49A04 Q6ZMZ7 Q8IY01 Q8N8H2 Q96DK4
Symbols ZNF533

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (8)

PMID Text
24599690 The study found significant associations between autism and two SNPs of the ZNF533 gene.
23029477 ZNF385B and VEGFA are strongly differentially expressed in serous ovarian carcinomas and correlate with survival.
22945289 The direct binding of ZNF385B with p53 has suggested the involvement of ZNF385B in B-cell apoptosis via modulation of p53 transactivation
20849254 the relationship between ZNF533, environmental factors, and the etiology of nonsyndromic orofacial clefts
20849254 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNMANFLRGFEEKGIKNDRPEDQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRKRVKQLSDGQP      1 - 70
PPPAQASPSSNSSTGSTCHTTTLPALVRTPTLMMQPSLDIKPFMSFPVDSSSAVGLFPNFNTMDPVQKAV     71 - 140
INHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSKHAKKVKALDATKNKPKMVPSKDSAKANPSC    141 - 210
SITPITGNNSDKSEDKGKLKASSSSQPSSSESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEK    211 - 280
AKKLLYCSLCKVAVNSLSQLEAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHC    281 - 350
EICDVHVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSP    351 - 420
LAAAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY                       421 - 471
//

Text Mined References (14)

PMID Year Title
26755636 2016 Exome sequencing and CRISPR/Cas genome editing identify mutations of ZAK as a cause of limb defects in humans and mice.
24599690 2014 Family-based association study of ZNF533, DOCK4 and IMMP2L gene polymorphisms linked to autism in a northeastern Chinese Han population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23029477 2012 ZNF385B and VEGFA are strongly differentially expressed in serous ovarian carcinomas and correlate with survival.
22945289 2012 ZNF385B is characteristically expressed in germinal center B cells and involved in B-cell apoptosis.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20849254 2011 Significant evidence of association between polymorphisms in ZNF533, environmental factors, and nonsyndromic orofacial clefts in the Western Han Chinese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
More...