Property Summary

NCBI Gene PubMed Count 8
PubMed Score 786.51
PubTator Score 2.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Amyotrophic Lateral Sclerosis 432 8.56666704940887E-6
group 4 medulloblastoma 1875 6.4538513696651E-4
ulcerative colitis 2087 8.88822673119893E-4
interstitial cystitis 2299 0.00133330964165164
osteosarcoma 7933 0.00196937455429712
primitive neuroectodermal tumor 3031 0.00474842961811214
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00839231247347992
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0091076800408928
adult high grade glioma 2148 0.00988017298074292
oligodendroglioma 2849 0.0131853286392786
astrocytic glioma 2241 0.0159752095440326
pilocytic astrocytoma 3086 0.0243976419000023
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0367601179188667
posterior fossa group B ependymoma 1530 0.0375010910540951
Disease Target Count Z-score Confidence
Waterhouse-Friderichsen syndrome 11 3.066 1.5

Expression

Synonym

Accession Q569H4 D3DSZ0 Q8IXY1 Q9NYI5
Symbols DSC54
LARGEN

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24656129 Largen, the product of a gene PRR16, increases cell size upon overexpression in human cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAKSKGNPSSSCPAEGPPAASKTKVKEQIKIIVEDLELVLGDLKDVAKELKEVVDQIDTLTSDLQLEDE      1 - 70
MTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKPNPPPPPPRLTPVKCEDPKRV     71 - 140
VPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEK    141 - 210
VQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRP    211 - 280
ATVPPPTAPKPQKTILRKSTTTTV                                                  281 - 304
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24656129 2014 Largen: a molecular regulator of mammalian cell size control.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15971941 2005 Derivation of multipotent mesenchymal precursors from human embryonic stem cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.