Property Summary

NCBI Gene PubMed Count 8
Grant Count 79
R01 Count 36
Funding $26,664,956.48
PubMed Score 786.51
PubTator Score 2.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q569H4 D3DSZ0 Q8IXY1 Q9NYI5
Symbols DSC54
LARGEN

Gene

Gene RIF (2)

PMID Text
24656129 Largen, the product of a gene PRR16, increases cell size upon overexpression in human cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAKSKGNPSSSCPAEGPPAASKTKVKEQIKIIVEDLELVLGDLKDVAKELKEVVDQIDTLTSDLQLEDE      1 - 70
MTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKPNPPPPPPRLTPVKCEDPKRV     71 - 140
VPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEK    141 - 210
VQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRP    211 - 280
ATVPPPTAPKPQKTILRKSTTTTV                                                  281 - 304
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24656129 2014 Largen: a molecular regulator of mammalian cell size control.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15971941 2005 Derivation of multipotent mesenchymal precursors from human embryonic stem cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.