Property Summary

NCBI Gene PubMed Count 8
PubMed Score 835.33
PubTator Score 2.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q569H4 D3DSZ0 Q8IXY1 Q9NYI5
Symbols DSC54
LARGEN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSAKSKGNPSSSCPAEGPPAASKTKVKEQIKIIVEDLELVLGDLKDVAKELKEVVDQIDTLTSDLQLEDE      1 - 70
MTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKPNPPPPPPRLTPVKCEDPKRV     71 - 140
VPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEK    141 - 210
VQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRP    211 - 280
ATVPPPTAPKPQKTILRKSTTTTV                                                  281 - 304
//

Text Mined References (9)

PMID Year Title