Property Summary

NCBI Gene PubMed Count 8
PubMed Score 835.33
PubTator Score 2.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MSAKSKGNPSSSCPAEGPPAASKTKVKEQIKIIVEDLELVLGDLKDVAKELKEVVDQIDTLTSDLQLEDE      1 - 70
MTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKPNPPPPPPRLTPVKCEDPKRV     71 - 140
VPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEK    141 - 210
VQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRP    211 - 280
ATVPPPTAPKPQKTILRKSTTTTV                                                  281 - 304
//

Text Mined References (9)

PMID Year Title