Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.74
PubTator Score 1.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.010 0.004

Synonym

Accession Q567V2 Q96P34 Q96QA0 Q9BSG4
Symbols FKSG24

Gene

Gene RIF (2)

PMID Text
24948607 The findings suggest MPV17L2 contributes to the biogenesis of the mitochondrial ribosome, uniting the two subunits to create the translationally competent monosome.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGC      1 - 70
SMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTVGESCQELREKF     71 - 140
WEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD        141 - 206
//

Text Mined References (8)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24948607 2014 MPV17L2 is required for ribosome assembly in mitochondria.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.