Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.61
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 540 6.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.400 6.0e-03

Gene RIF (4)

AA Sequence

MTDNELSALVVDNGSGMCKAGFGGDDAPRAVFPSMIGRPRHQGVMVGMGQKDCYVGDEAQSKRGVLTLKY      1 - 70
PIEHGVVTNWDDMEKIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAV     71 - 140
LSLYASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYNFTTTAEREIV    141 - 210
RDVKEKLCYVALDFEQEMVRAAASSSPERSYELPDGQVITIGNERFRCPEAIFQPSFLGIESSGIHETTF    211 - 280
NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIITLAPSTMKIKIIAPPERKYSVWIGGSILASL    281 - 350
STFQQMWISKQEYDEAGPPIVHRKCF                                                351 - 376
//

Text Mined References (14)

PMID Year Title