Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.39
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Multiple Sclerosis 498 0.00601258971594124

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.400 0.006

Synonym

Accession Q562R1 B2RPJ1 Q562R2 Q562S9 Q562X8
Symbols ACT

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of actin, beta-like 2 (ACTBL2) expression by HIV-1 Vpr in Vpr transduced macrophages
22562506 -actin is downregulated in the corneal stroma of patients with KC, which may be related to reduced levels of a stabilizing factor (HuR) for beta-actin mRNA.

AA Sequence

MTDNELSALVVDNGSGMCKAGFGGDDAPRAVFPSMIGRPRHQGVMVGMGQKDCYVGDEAQSKRGVLTLKY      1 - 70
PIEHGVVTNWDDMEKIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAV     71 - 140
LSLYASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYNFTTTAEREIV    141 - 210
RDVKEKLCYVALDFEQEMVRAAASSSPERSYELPDGQVITIGNERFRCPEAIFQPSFLGIESSGIHETTF    211 - 280
NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIITLAPSTMKIKIIAPPERKYSVWIGGSILASL    281 - 350
STFQQMWISKQEYDEAGPPIVHRKCF                                                351 - 376
//

Text Mined References (12)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22562506 2012 Downregulation of ?-actin gene and human antigen R in human keratoconus.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16824795 2006 Identification of a novel actin isoform in hepatocellular carcinoma.
More...