Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.39
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Multiple Sclerosis 498

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.400 0.006

Gene RIF (2)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of actin, beta-like 2 (ACTBL2) expression by HIV-1 Vpr in Vpr transduced macrophages
22562506 -actin is downregulated in the corneal stroma of patients with KC, which may be related to reduced levels of a stabilizing factor (HuR) for beta-actin mRNA.

AA Sequence

MTDNELSALVVDNGSGMCKAGFGGDDAPRAVFPSMIGRPRHQGVMVGMGQKDCYVGDEAQSKRGVLTLKY      1 - 70
PIEHGVVTNWDDMEKIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAV     71 - 140
LSLYASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYNFTTTAEREIV    141 - 210
RDVKEKLCYVALDFEQEMVRAAASSSPERSYELPDGQVITIGNERFRCPEAIFQPSFLGIESSGIHETTF    211 - 280
NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIITLAPSTMKIKIIAPPERKYSVWIGGSILASL    281 - 350
STFQQMWISKQEYDEAGPPIVHRKCF                                                351 - 376
//

Text Mined References (12)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22562506 2012 Downregulation of ?-actin gene and human antigen R in human keratoconus.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16824795 2006 Identification of a novel actin isoform in hepatocellular carcinoma.
More...