Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.26
PubTator Score 9.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.125 3.7e-02
adrenocortical carcinoma 1.621 2.7e-03
adult high grade glioma 1.900 6.2e-05
Atopic dermatitis 1.600 1.2e-04
atypical teratoid / rhabdoid tumor 1.800 3.8e-06
Breast cancer 1.200 7.1e-08
ductal carcinoma in situ 1.500 3.0e-04
Endometriosis 1.281 2.3e-02
ependymoma 1.200 5.3e-06
gastric carcinoma 1.500 4.5e-02
glioblastoma 2.500 6.3e-10
group 3 medulloblastoma 2.200 8.0e-05
intraductal papillary-mucinous carcinoma... 1.600 3.9e-04
intraductal papillary-mucinous neoplasm ... 2.300 7.7e-04
invasive ductal carcinoma 1.900 5.2e-05
medulloblastoma, large-cell 2.000 1.5e-05
non-small cell lung cancer 1.855 4.6e-21
ovarian cancer -1.600 1.1e-03
pancreatic cancer 1.100 1.0e-04
pancreatic ductal adenocarcinoma liver m... 1.018 1.8e-02
primitive neuroectodermal tumor 2.400 6.3e-06
psoriasis 1.400 8.5e-39
Rheumatoid arthritis 1.100 1.3e-02
ulcerative colitis 1.200 9.5e-04

Gene RIF (5)

AA Sequence

MECPVMETGSLFTSGIKRHLKDKRISKTTKLNVSLASKIKTKILNNSSIFKISLKHNNRALAQALSREKE      1 - 70
NSRRITTEKMLLQKEVEKLNFENTFLRLKLNNLNKKLIDIEALMNNNLITAIEMSSLSEFHQSSFLLSAS     71 - 140
KKKRISKQCKLMRLPFARVPLTSNDDEDEDKEKMQCDNNIKSKTLPDIPSSGSTTQPLSTQDNSEVLFLK    141 - 210
ENNQNVYGLDDSEHISSIVDVPPRESHSHSDQSSKTSLMSEMRNAQSIGRRWEKPSPSNVTERKKRGSSW    211 - 280
ESNNLSADTPCATVLDKQHISSPELNCNNEINGHTNETNTEMQRNKQDLPGLSSESAREPNAECMNQIED    281 - 350
NDDFQLQKTVYDADMDLTASEVSKIVTVSTGIKKKSNKKTNEHGMKTFRKVKDSSSEKKRERSKRQFKNS    351 - 420
SDVDIGEKIENRTERSDVLDGKRGAEDPGFIFNNEQLAQMNEQLAQVNELKKMTLQTGFEQGDRENVLCN    421 - 490
KKEKRITNEQEETYSLSQSSGKFHQESKFDKGQNSLTCNKSKASRQTFVIHKLEKDNLLPNQKDKVTIYE    491 - 560
NLDVTNEFHTANLSTKDNGNLCDYGTHNILDLKKYVTDIQPSEQNESNINKLRKKVNRKTEIISGMNHMY    561 - 630
EDNDKDVVHGLKKGNFFFKTQEDKEPISENIEVSKELQIPALSTRDNENQCDYRTQNVLGLQKQITNMYP    631 - 700
VQQNESKVNKKLRQKVNRKTEIISEVNHLDNDKSIEYTVKSHSLFLTQKDKEIIPGNLEDPSEFETPALS    701 - 770
TKDSGNLYDSEIQNVLGVKHGHDMQPACQNDSKIGKKPRLNVCQKSEIIPETNQIYENDNKGVHDLEKDN    771 - 840
FFSLTPKDKETISENLQVTNEFQTVDLLIKDNGNLCDYDTQNILELKKYVTDRKSAEQNESKINKLRNKV    841 - 910
NWKTEIISEMNQIYEDNDKDAHVQESYTKDLDFKVNKSKQKLECQDIINKHYMEVNSNEKESCDQILDSY    911 - 980
KVVKKRKKESSCKAKNILTKAKNKLASQLTESSQTSISLESDLKHITSEADSDPGNPVELCKTQKQSTTT    981 - 1050
LNKKDLPFVEEIKEGECQVKKVNKMTSKSKKRKTSIDPSPESHEVMERILDSVQGKSTVSEQADKENNLE   1051 - 1120
NEKMVKNKPDFYTKAFRSLSEIHSPNIQDSSFDSVREGLVPLSVSSGKNVIIKENFALECSPAFQVSDDE   1121 - 1190
HEKMNKMKFKVNRRTQKSGIGDRPLQDLSNTSFVSNNTAESENKSEDLSSERTSRRRRCTPFYFKEPSLR   1191 - 1260
DKMRR                                                                    1261 - 1265
//

Text Mined References (25)

PMID Year Title