Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.12
PubTator Score 9.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.45740880251979E-39
non-small cell lung cancer 2798 4.63261210294134E-21
glioblastoma 5572 6.33489038035637E-10
atypical teratoid/rhabdoid tumor 1095 1.8617116935442E-8
sonic hedgehog group medulloblastoma 1482 1.96805020950509E-8
Breast cancer 3099 7.12402814213802E-8
ovarian cancer 8492 1.18472832278159E-7
posterior fossa group A ependymoma 1511 9.10626845628081E-7
pediatric high grade glioma 2712 2.32751920205107E-6
primitive neuroectodermal tumor 3031 6.26101116111805E-6
medulloblastoma, large-cell 6234 1.50215315456535E-5
invasive ductal carcinoma 2950 5.15151815657225E-5
pancreatic cancer 2300 1.02649649564083E-4
Atopic dermatitis 944 1.17456682362173E-4
ductal carcinoma in situ 1745 2.97536356258353E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.60100359076042E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.87222152837699E-4
ulcerative colitis 2087 9.51513975469404E-4
adrenocortical carcinoma 1427 9.6962906398612E-4
Rheumatoid Arthritis 1171 0.0128378090318033
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0180976815292495
Endometriosis 535 0.0234221531744891
active Crohn's disease 918 0.037114478813145
gastric carcinoma 832 0.045182781954053

Expression

Synonym

Accession Q562F6 Q53RR9 Q53T20 Q86XY4 Q8IWK2 Q8IZK1 Q8N1Q5 Q96LQ3
Symbols SGOL2
TRIPIN

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (3)

PMID Text
24192037 Sgol2's ability to protect cohesin depends on its interaction with PP2A, as is its ability to silence the SAC, with the latter being mediated by direct binding to Mad2
20889715 identified the phosphorylation of hSgo2 by Aurora B at the N-terminal coiled-coil region and the middle region, and showed that these phosphorylations separately promote binding of hSgo2 to PP2A and MCAK
19898482 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MECPVMETGSLFTSGIKRHLKDKRISKTTKLNVSLASKIKTKILNNSSIFKISLKHNNRALAQALSREKE      1 - 70
NSRRITTEKMLLQKEVEKLNFENTFLRLKLNNLNKKLIDIEALMNNNLITAIEMSSLSEFHQSSFLLSAS     71 - 140
KKKRISKQCKLMRLPFARVPLTSNDDEDEDKEKMQCDNNIKSKTLPDIPSSGSTTQPLSTQDNSEVLFLK    141 - 210
ENNQNVYGLDDSEHISSIVDVPPRESHSHSDQSSKTSLMSEMRNAQSIGRRWEKPSPSNVTERKKRGSSW    211 - 280
ESNNLSADTPCATVLDKQHISSPELNCNNEINGHTNETNTEMQRNKQDLPGLSSESAREPNAECMNQIED    281 - 350
NDDFQLQKTVYDADMDLTASEVSKIVTVSTGIKKKSNKKTNEHGMKTFRKVKDSSSEKKRERSKRQFKNS    351 - 420
SDVDIGEKIENRTERSDVLDGKRGAEDPGFIFNNEQLAQMNEQLAQVNELKKMTLQTGFEQGDRENVLCN    421 - 490
KKEKRITNEQEETYSLSQSSGKFHQESKFDKGQNSLTCNKSKASRQTFVIHKLEKDNLLPNQKDKVTIYE    491 - 560
NLDVTNEFHTANLSTKDNGNLCDYGTHNILDLKKYVTDIQPSEQNESNINKLRKKVNRKTEIISGMNHMY    561 - 630
EDNDKDVVHGLKKGNFFFKTQEDKEPISENIEVSKELQIPALSTRDNENQCDYRTQNVLGLQKQITNMYP    631 - 700
VQQNESKVNKKLRQKVNRKTEIISEVNHLDNDKSIEYTVKSHSLFLTQKDKEIIPGNLEDPSEFETPALS    701 - 770
TKDSGNLYDSEIQNVLGVKHGHDMQPACQNDSKIGKKPRLNVCQKSEIIPETNQIYENDNKGVHDLEKDN    771 - 840
FFSLTPKDKETISENLQVTNEFQTVDLLIKDNGNLCDYDTQNILELKKYVTDRKSAEQNESKINKLRNKV    841 - 910
NWKTEIISEMNQIYEDNDKDAHVQESYTKDLDFKVNKSKQKLECQDIINKHYMEVNSNEKESCDQILDSY    911 - 980
KVVKKRKKESSCKAKNILTKAKNKLASQLTESSQTSISLESDLKHITSEADSDPGNPVELCKTQKQSTTT    981 - 1050
LNKKDLPFVEEIKEGECQVKKVNKMTSKSKKRKTSIDPSPESHEVMERILDSVQGKSTVSEQADKENNLE   1051 - 1120
NEKMVKNKPDFYTKAFRSLSEIHSPNIQDSSFDSVREGLVPLSVSSGKNVIIKENFALECSPAFQVSDDE   1121 - 1190
HEKMNKMKFKVNRRTQKSGIGDRPLQDLSNTSFVSNNTAESENKSEDLSSERTSRRRRCTPFYFKEPSLR   1191 - 1260
DKMRR                                                                    1261 - 1265
//

Text Mined References (22)

PMID Year Title
24192037 2013 Sgol2 provides a regulatory platform that coordinates essential cell cycle processes during meiosis I in oocytes.
21666598 2011 Shugoshin is a Mad1/Cdc20-like interactor of Mad2.
21402792 2011 The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment.
20889715 2010 Phosphorylation of mammalian Sgo2 by Aurora B recruits PP2A and MCAK to centromeres.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18084284 2008 Unified mode of centromeric protection by shugoshin in mammalian oocytes and somatic cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17485487 2007 Tripin/hSgo2 recruits MCAK to the inner centromere to correct defective kinetochore attachments.
More...