Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.30
PubTator Score 0.88

Knowledge Summary


No data available


Gene RIF (1)

25122053 INO80D is a subunit of the human INO80 chromatin remodeling complex; its Ser818Cys mutation has a role in accelerated arterial aging

AA Sequence

DHITSPHTTSYSGDNMAAPVCFRGYHRPASVAWGLLLN                                    841 - 878

Text Mined References (12)

PMID Year Title
25122053 2014 Whole exome sequencing implicates an INO80D mutation in a syndrome of aortic hypoplasia, premature atherosclerosis, and arterial stiffness.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.