Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.30
PubTator Score 0.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.42846161793143E-11
juvenile dermatomyositis 1189 8.63633841254447E-10
osteosarcoma 7933 3.42691221088498E-8
Pick disease 1893 9.40449576594885E-8
Rheumatoid Arthritis 1171 0.00165601887061592
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0023951701212742
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00254893483425701
pancreatic ductal adenocarcinoma liver metastasis 1795 0.003567443440382
oligodendroglioma 2849 0.00535548356277794
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00762673479803615
Atopic dermatitis 944 0.00853003182631342
medulloblastoma, large-cell 6234 0.0112946734649281
Alzheimer's disease 644 0.0145742616654345
glioblastoma 5572 0.0190090287609385
atypical teratoid / rhabdoid tumor 4369 0.0355162388354193

Expression

Synonym

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
25122053 INO80D is a subunit of the human INO80 chromatin remodeling complex; its Ser818Cys mutation has a role in accelerated arterial aging

AA Sequence

MYEGKHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQRCTNPIPKSE      1 - 70
DRRYCNSHLQVLGFIPKKERKKKNDPIDEVKVRHQMDTMAFSLTVPTLALKMPNGLDGMSLSPPGARVPL     71 - 140
HYLETELEDPFAFNEEDDDLKKGATVRKKLQSKLAQNRQRQRETEILKVRQEHFSPPPAPSQQQPPQQHS    141 - 210
HLSPLSTSLKPPAPPQGSVCKSPQPQNTSLPMQGVAPTTHTIAQARQLSHKRPLPLLPSSRAPTVDPPRT    211 - 280
DRILMKATAFSPHFSCISRLQRLVKLCTQKHQLDTDLFPHLGLDWSEESGEEPEDSEQASPYQVAWSIRE    281 - 350
TLRYQRHASDDDDAESRSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRKALLQAASKEPECTGQL    351 - 420
IQELRRAACSRTSISRTKLREVEPAACSGTVKGEQCANKALPFTRHCFQHILLNHSQQLFSSCTAKFADG    421 - 490
QQCSVPVFDITHQTPLCEEHAKKMDNFLRGDNSRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQK    491 - 560
PIPPAVPQGNLSMPASVSLPVEASHIRSPSTPELSADELPDDIANEITDIPHDLELNQEDFSDVLPRLPD    561 - 630
DLQDFDFFEGKNGDLLPTTEEAEELERALQAVTSLECLSTIGVLAQSDGVPVQELSDRGIGVFSTGTGAS    631 - 700
GIQSLSREVNTDLGELLNGRIVHDNFSSLELDENLLRSATLSNPPTPLAGQIQGQFSAPANVGLTSATLI    701 - 770
SQSALGERAFPGQFHGLHDGSHASQRPHPAQLLSKADDLITSRQQYSSDHSHSSPHGSHYDSEHVPSPYS    771 - 840
DHITSPHTTSYSGDNMAAPVCFRGYHRPASVAWGLLLN                                    841 - 878
//

Text Mined References (12)

PMID Year Title
25122053 2014 Whole exome sequencing implicates an INO80D mutation in a syndrome of aortic hypoplasia, premature atherosclerosis, and arterial stiffness.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...