Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
Funding $240,005
PubMed Score 56.24
PubTator Score 35.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q53TN4 B2RE79 B4DWD7 Q6KC16 Q6KC17 Q6P147 Q6ZR51 Q9H0Q8 Q9H5G5
Symbols DCYTB
FRRS3
CYB561A2

Gene

PANTHER Protein Class (2)

Gene RIF (12)

PMID Text
23012398 Letter: report mutations in CYBRD1 promoter in and possible role in iron hemostasis in patients with porphyria cutanea tarda.
22773607 Polymorphisms in CYBRD1 modulates iron phenotype in HFE p.C282Y homozygous hemochromatosis.
20587610 Observational study of gene-disease association. (HuGE Navigator)
19673882 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18492824 The results of this study confirm that Dcytb can act as a ferric reductase that stimulates iron uptake in Caco-2 cells.
18194661 Functional characterization of Cybrd1 heme groups and iron/ascorbate metabolism.
18092813 The current study concerns the recombinant expression, purification, and initial spectroscopic characterization of a recombinant form of the human ferric reductase.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17068337 Duodenal cytochrome b present in human erythrocytes may contribute to their ability to reduce extracellular monodehydroascorbate.
More...

AA Sequence

MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIAIIVYR      1 - 70
LPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLSGFS     71 - 140
VFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILV    141 - 210
FGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEA    211 - 280
GQRSTM                                                                    281 - 286
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23012398 2013 Iron homeostasis in porphyria cutanea tarda: mutation analysis of promoter regions of CP, CYBRD1, HAMP and SLC40A1.
22773607 2012 CYBRD1 as a modifier gene that modulates iron phenotype in HFE p.C282Y homozygous patients.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19673882 2009 A novel association between a SNP in CYBRD1 and serum ferritin levels in a cohort study of HFE hereditary haemochromatosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...