Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.15
PubTator Score 8.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.5e-05
glioblastoma 1.100 5.6e-04
psoriasis 1.600 3.8e-04

Synonym

Accession Q53T59 B2RAW2 D6W529 Q86VC2 Q8N367
Symbols ETM2
HS1-BP3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKK      1 - 70
YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSP     71 - 140
GAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSK    141 - 210
KPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSVDPLKLFDDPDLGGAIPLGDS    211 - 280
LLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKA    281 - 350
GPAEAVAGQQKPQEQIQAMDEMDILQYIQDHDTPAQAAPSLF                                351 - 392
//

Text Mined References (19)

PMID Year Title