Property Summary

NCBI Gene PubMed Count 26
PubMed Score 7.94
PubTator Score 3.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.843 6.4e-04
adult high grade glioma 1.400 3.3e-04
atypical teratoid / rhabdoid tumor 1.200 8.6e-03
autosomal dominant Emery-Dreifuss muscul... 1.020 4.8e-03
cystic fibrosis 1.121 3.0e-05
ductal carcinoma in situ -1.200 3.2e-03
ependymoma 1.200 1.8e-04
gastric carcinoma -1.800 4.5e-02
intraductal papillary-mucinous adenoma (... 1.100 8.7e-04
intraductal papillary-mucinous carcinoma... -1.300 1.3e-03
invasive ductal carcinoma -1.500 4.1e-03
lung cancer -1.700 7.6e-04
malignant mesothelioma -1.100 9.0e-05
medulloblastoma, large-cell 1.400 4.2e-04
osteosarcoma -1.713 2.0e-02
ovarian cancer -2.900 1.1e-07
pancreatic cancer -1.400 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.157 4.3e-02
Pick disease 1.100 3.7e-03
psoriasis -1.600 4.4e-04
spina bifida -1.936 3.7e-02
subependymal giant cell astrocytoma 2.177 1.7e-02

Gene RIF (9)

AA Sequence

MCGRAAEAAASSRTPGREMGQAVTRRLGAGARAAPRRAMDGRTPRPQDAPARRKPKAKAPLPPAETKYTD      1 - 70
VSSAADSVESTAFIMEQKENMIDKDVELSVVLPGDIIKSTTVHGSKPMMDLLIFLCAQYHLNPSSYTIDL     71 - 140
LSAEQNHIKFKPNTPIGMLEVEKVILKPKMLDKKKPTPIIPEKTVRVVINFKKTQKTIVRVSPHASLQEL    141 - 210
APIICSKCEFDPLHTLLLKDYQSQEPLDLTKSLNDLGLRELYAMDVNRESCQISQNLDIMKEKENKGFFS    211 - 280
FFQRSKKKRDQTASAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQSVPQDLAH    281 - 350
IQERPASCIVKSMSVDETDKSPCEAGRVRAGSLQLSSMSAGNSSLRRTKRKAPSPPSKIPPHQSDENSRV    351 - 420
TALQPVDGVPPDSASEANSPEELSSPETFHPGLSSQEQCTAPKLMEETSVFECPGTPEAAITSLTSGISS    421 - 490
DYSLEEIDEKEELSEVPKVEAENISPKSQDIPFVSTDIINTLKNDPDSALGNGSGEFSQNSMEEKQETKS    491 - 560
TDGQEPHSVVYDTSNGKKVVDSIRNLKSLGPNQENVQNEIIVYPENTEDNMKNGVKKTEINVEGVAKNNN    561 - 630
IDMEVERPSNSEAHETDTAISYKENHLAASSVPDQKLNQPSAEKTKDAAIQTTPSCNSFDGKHQDHNLSD    631 - 700
SKVEECVQTSNNNISTQHSCLSSQDSVNTSREFRSQGTLIIHSEDPLTVKDPICAHGNDDLLPPVDRIDK    701 - 770
NSTASYLKNYPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEISKDWQSETIEYKDDQDMHAL    771 - 840
GKKHTHENVKETAIQTEDSAISESPEEPLPNLKPKPNLRTEHQVPSSVSSPDDAMVSPLKPAPKMTRDTG    841 - 910
TAPFAPNLEEINNILESKFKSRASNAQAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEA    911 - 980
ERDMLPSPEQTLSPLSKMPHSVPQPLVEKTDDDVIGQAPAEASPPPIAPKPVTIPASQVSTQNLKTLKTF    981 - 1050
GAPRPYSSSGPSPFALAVVKRSQSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVSDKENN   1051 - 1120
SAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRS   1121 - 1190
RLSHSMSPDAQDGH                                                           1191 - 1204
//

Text Mined References (32)

PMID Year Title