Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MEDYALTFGINPFIALMIQPIVTMTVVDNQGLGLPVDIQHKAKPSPKASQMLPPDLGPPSFQNLLSPSEK      1 - 70
LEPWDPGMRKLTVQTCGLTFIHPAGHGLCHPTAEASAETLSSTALNRPSVREGACNEKSTENKKPQDSVL     71 - 140
WSHSRWFQGN                                                                141 - 150
//

Text Mined References (10)

PMID Year Title