Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 1.7e-02
lung cancer 3.500 8.7e-07
medulloblastoma, large-cell 1.100 5.5e-03
non-small cell lung cancer 1.550 1.2e-23
ovarian cancer 1.200 1.8e-04
psoriasis 1.100 1.3e-03
ulcerative colitis -1.200 4.6e-07

Synonym

Accession Q53S58 Q9BT20
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MAGPLWRTAAFVQRHRTGLLVGSCAGLFGVPISYHLFPDPVVQWLYQYWPQGQPAPLPPQLQSLFQEVLQ      1 - 70
DIGVPSGHCYKPFTTFTFQPVSAGFPRLPAGAVVGIPASFLGDLVINTNHPVVIHGHTVDWRSPAGARLR     71 - 140
ASLTLSREAQKFALAREVVYLESSTTAVHALLAPACLAGTWALGVGAKYTLGLHAGPMNLRAAFSLVAAV    141 - 210
AGFVAYAFSQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVP    211 - 280
RHLFRIKHLPYTTRRDSVLQMWRGMLNPGRS                                           281 - 311
//

Text Mined References (7)

PMID Year Title