Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.29
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
Breast cancer 1.300 6.5e-07
ovarian cancer 2.200 3.2e-05

Gene RIF (6)

AA Sequence

MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESE      1 - 70
EFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR                                      71 - 107
//

Text Mined References (14)

PMID Year Title