Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis -1.700 1.2e-03
non primary Sjogren syndrome sicca 1.300 2.4e-02
non-small cell lung cancer 1.084 1.7e-09
ovarian cancer 1.100 6.9e-03

Gene RIF (1)

AA Sequence

MRRCSLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTVANVISVGSGL      1 - 70
LSVSVGLVALLASRNLLRPPLHWVLLALALVNLLLSVACSLGLLLAVSLTVANGGRRLIADCHPGLLDPL     71 - 140
VPLDEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEAALSGYCCVAALTLRGVGPCRKDGLQGQLEEMT    141 - 210
ELESPKCKRQENEQLLDQNQEIRASQRSWV                                            211 - 240
//

Text Mined References (8)

PMID Year Title