Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.70

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.66061065894926E-9
interstitial cystitis 2299 4.26917359558733E-6
ovarian cancer 8492 0.00693391946643801
non primary Sjogren syndrome sicca 840 0.0241267690116944


  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer 1.084 0.000
interstitial cystitis -2.300 0.000
non primary Sjogren syndrome sicca 1.300 0.024
ovarian cancer 1.100 0.007


Accession Q53RY4 B7ZL49 Q6UW42 Q8IWS5 KCP-3
Symbols KCP3


  Ortholog (11)

Gene RIF (1)

18976975 Knockdown of keratinocyte associated protein 3 (KRTCAP3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

ELESPKCKRQENEQLLDQNQEIRASQRSWV                                            211 - 240

Text Mined References (8)

PMID Year Title
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12752121 2003 Identification of novel genes for secreted and membrane-anchored proteins in human keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.