Property Summary

NCBI Gene PubMed Count 9
PubMed Score 16.72
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 6.8e-03
atypical teratoid / rhabdoid tumor -1.100 8.0e-04
ependymoma -1.400 8.9e-03
group 3 medulloblastoma -1.400 2.7e-02
intraductal papillary-mucinous neoplasm ... -1.200 1.0e-02
lung carcinoma 1.400 4.0e-27
medulloblastoma, large-cell -1.700 9.4e-04
oligodendroglioma -1.400 2.2e-03
tuberculosis -1.200 1.0e-04

Gene RIF (3)

AA Sequence

MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVG      1 - 70
RVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISEC     71 - 140
SSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAG    141 - 210
FHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPV    211 - 280
CPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKT    281 - 350
PITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDR    351 - 420
SFQANHVSKVTIFVSPYDF                                                       421 - 439
//

Text Mined References (12)

PMID Year Title