Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
Funding $461,063.4
PubMed Score 16.84
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.007
ependymoma -1.400 0.009
oligodendroglioma -1.400 0.002
atypical teratoid / rhabdoid tumor -1.100 0.001
group 3 medulloblastoma -1.400 0.027
medulloblastoma, large-cell -1.700 0.001
tuberculosis -1.200 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.010
lung carcinoma 1.400 0.000

Gene RIF (3)

PMID Text
24694933 Heterozygous loss of FBLN7 and TMEM87B account for some of the clinical features, including cardiac defects and craniofacial abnormalities associated with 2q13 deletion syndrome.
24480309 Fbln7-C terminal fragment inhibited the HUVEC tube formation and the vessel sprouting in aortic ring assays.
19229767 Dysregulation of fibulin expression by anti-Ro/SSA antibodiess may contribute to disorganization of the extracellular environment and thus cause injury to the salivary gland architecture and functionality observed in Sjogren syndrome

AA Sequence

MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVG      1 - 70
RVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISEC     71 - 140
SSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAG    141 - 210
FHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPV    211 - 280
CPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKT    281 - 350
PITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDR    351 - 420
SFQANHVSKVTIFVSPYDF                                                       421 - 439
//

Text Mined References (12)

PMID Year Title
24694933 2014 Functional analysis of candidate genes in 2q13 deletion syndrome implicates FBLN7 and TMEM87B deficiency in congenital heart defects and FBLN7 in craniofacial malformations.
24480309 2014 A C-terminal fragment of fibulin-7 interacts with endothelial cells and inhibits their tube formation in culture.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
19229767 Anti-Ro/SSA autoantibody-mediated regulation of extracellular matrix fibulins in human epithelial cells of the salivary gland.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17699513 2007 TM14 is a new member of the fibulin family (fibulin-7) that interacts with extracellular matrix molecules and is active for cell binding.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...